KEGG   Phaeodactylum tricornutum: PHATRDRAFT_14453Help
Entry
PHATRDRAFT_14453  CDS       T01075                                 

Gene name
hCDK7
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PHATRDRAFT_14453 (hCDK7)
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PHATRDRAFT_14453 (hCDK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 358 aa AA seqDB search
VGDRYDLLRMLGRGSYGEVAQAIDLYAGRADAFVAIKRILSPFDQEVDAVRLYREIHILR
RMRGHDCIIQLLDVVQPPTDDLDDFHDLYLVFEYVDTDLYKLIMSPQYLTTEHIQTFLYQ
MLTGLKFIHSFSVIHRDLKPANILLNEDCSLKICDFGLARIVDSSSMSTSKQDDDVQRLR
SPGSFGLPPKVGLTRQLTKHVVTRWYRAPELILIQPYTSAVDIWSLGCILAELLSMQEGN
VSGYEDRKPLFPGGKCFPLSGEGETMKADERLDQLSVIFGVIGSPPPEDISAIGKATAYI
DSLGKIEGKPLEKVFPAADPLALDLLQKMLYFNPKKRCTAEEALEHALFKNVRRKELE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtcggagatcggtacgatctcttacggatgctgggccggggctcttatggagaagttgcg
caggccattgatttgtatgcgggacgtgcggatgcctttgtggcgataaaacgaatcctc
tccccgtttgatcaagaagtagacgctgtacgcctgtaccgggagattcacattctccgg
cggatgcgggggcacgactgcattattcagttgttggatgtcgtccagcctcccactgac
gatctagacgactttcatgatctgtatttggtgttcgagtatgttgacactgatctttac
aagctcatcatgtcaccacaatatctgacaacagagcacattcagacatttttgtatcag
atgctcaccgggttgaagtttattcactccttttctgtgattcatagagatctgaaaccc
gccaatattttgctcaacgaagactgttcgttaaagatttgcgattttgggctggctaga
atagtcgactcgtcgtccatgtcaacttcgaaacaagacgacgatgtacagcgacttaga
tctcccggaagctttgggctccctccaaaagttggtttgacccgacaactgacaaagcac
gttgtgacccgttggtaccgtgctcccgaactcattcttatccagccatatacttcggca
gtcgatatttggagtcttggttgtatcctagcagagctcctgagtatgcaggaaggtaac
gtttccggatacgaggaccgaaagccactttttccaggtgggaaatgctttcctctctct
ggagaaggcgaaaccatgaaggcggatgaacgtttagaccagctgagtgttatttttggg
gtcatcggaagtccgcccccggaagatatatcagcgataggaaaggcgaccgcctacatt
gattctctcggcaaaatagagggcaaaccactagagaaagttttcccggctgctgatcct
ctagccttggatctgctgcaaaaaatgctttatttcaatccaaagaaacgatgcacagcc
gaagaggcgttagaacatgctctttttaaaaacgtgcggcgaaaagagctggaa

DBGET integrated database retrieval system