KEGG   Phaeodactylum tricornutum: PHATRDRAFT_14553Help
Entry
PHATRDRAFT_14553  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PHATRDRAFT_14553
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   PHATRDRAFT_14553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
15
AA seq 321 aa AA seqDB search
DDENYDYIVTSGEVFFGRYNIKERIGKGSFGQVVRAEDIETNQEVAIKIIKSKKPFALQA
KTEIELLTHLLDKDVEDQHNVVRLLTHFVYRGHQCLVFEMLSLNLYELLKNTQFSGVSLN
LIRKFAKQVLKALSFLARPDVDVIHCDLKPENILLRHPKKSGVKVIDFGSSCRSNKRMYS
YIQSRFYRSPEVILGLPYGVAIDMWSLGCILAEMHTGEPVFSGSDQFDQMQKIVKILGMI
PNSMLNRSSSQTRNQFFQRKQSTVTGREEWTIRQVKKSSSSFEAYNTQRNYELFVDLVYK
MLAYEPDQRITPAEAMAHPFI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gacgacgagaattatgactatattgtaacaagtggcgaagtcttctttggacggtacaac
atcaaagaacgtattggtaaaggatccttcggtcaagtagttcgtgcggaggacattgaa
acaaaccaggaagtggcaataaaaattatcaaatcgaagaaaccctttgcactacaggca
aaaacggaaatcgagcttttgacacacttgctggataaggatgttgaagatcagcacaac
gttgtgcgactcttaacccattttgtttatcgtggccaccaatgtcttgtttttgagatg
ctttctcttaatctatatgaattgttgaagaatacgcagtttagcggtgtatcattgaat
ctaattcgaaagttcgccaagcaagttttgaaggcgctctcatttcttgcccgaccggac
gtggatgttattcattgtgatttgaaaccagaaaatattttactgcggcatccaaagaag
agcggcgtgaaagttattgattttggatcatcatgtcggtcaaacaaacggatgtattct
tatattcaaagtcgcttctatcggtcacctgaggtcatacttggactgccttacggcgtg
gcgattgacatgtggagtcttggatgtatattggcagagatgcacactggtgaacccgtt
ttttccggctccgatcagtttgatcagatgcaaaagatagttaaaatacttggcatgatc
cccaacagcatgctcaaccgatcgagcagtcaaacccggaatcagttctttcagcgaaaa
caatcgactgttaccgggcgagaagaatggacgatacgtcaagtaaaaaagtcctcatcc
tctttcgaggcgtacaacacccagcgaaattacgaacttttcgtcgaccttgtatacaag
atgctagcctacgagcctgatcaaagaattacgcctgcagaagcgatggcgcatcctttc
att

DBGET integrated database retrieval system