KEGG   Phaeodactylum tricornutum: PHATRDRAFT_15214Help
Entry
PHATRDRAFT_15214  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PHATRDRAFT_15214
Enzymes [BR:pti01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PHATRDRAFT_15214
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 111 aa AA seqDB search
MSLSIAVPNEYGYVVLTSVVGGFVTSTILGGFVMKARAQYQVPYPNLYATPGFHKQADAF
NRVQRGHQCFFETYSVFALMALIGGLKHPIISAGSAVLYHVGSFLFLKGYA
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagcctttccatcgccgttcccaatgagtacggctatgtcgttctcacgtctgtcgtt
ggaggctttgttacgagtactatccttggcggttttgtcatgaaagctcgcgctcaatat
caggtcccttatcccaacttgtatgcaactccgggctttcataagcaggcggacgctttc
aaccgcgttcaacgtggtcatcagtgcttctttgaaacgtattcagtatttgcgctcatg
gccttgatcggtggcctgaagcatccgataatttctgctggttcggctgttttgtaccac
gtgggcagtttcctcttcctcaaagggtatgcg

DBGET integrated database retrieval system