KEGG   Phaeodactylum tricornutum: PHATRDRAFT_16490Help
Entry
PHATRDRAFT_16490  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pti  Phaeodactylum tricornutum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHATRDRAFT_16490
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PHATRDRAFT_16490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
26
AA seq 281 aa AA seqDB search
EFIPLRLLRKDILSHDTRRFTFALPNPKAVLGLPTGQHVVLKCTHPDTGKPVQRSYTPVT
DNRVLGEMALVIKVYRPNDVFPQGGTMSQHVDDLRIGDAVLVKGPKGHLNFYDPTVAAFT
VKPLGKPLESRTARNICLLAGGTGLTPCLQILHAIFRHENNDNSHVSCKMIYANQTPDDI
LCREELETLARAFPTRFQVWYTVDRTTTAMPTSNGSTKEAEETWAYDVGFLNKKMIEKHG
LFPGQESSTQFFMCGPPPMIKFACLPALQELGFSEKDWVIF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gaatttattcccttgcgtctcctccgcaaggacattctcagtcacgatacgcgtcgtttc
acctttgctttgcccaatccgaaggccgtcctcggattgcccaccggacagcacgtcgtc
ctcaagtgcacgcacccggacacgggcaagcccgtacagcgctcctacacacccgtcacg
gataatagggtcctgggggaaatggctctcgtgattaaagtctaccgtcccaacgatgtt
tttccgcaagggggcaccatgagtcagcacgtggacgacttgcgaatcggcgatgcggtg
ctcgtcaagggacccaagggacacttgaacttttacgatcccaccgtcgccgcctttacc
gtcaaaccactcggcaagccgctggagtcacggacggcccggaatatttgcttgttggcc
gggggaaccggactgacgccctgtttgcaaatcttgcacgccatttttcgacacgaaaat
aacgataatagtcacgtgtcctgcaaaatgatctacgccaaccaaacaccggacgatatc
ctgtgtcgggaagaactcgagacactcgcccgggcgtttcccacaagattccaagtgtgg
tataccgtagatcggacgaccacggctatgcccaccagcaacgggtcaaccaaggaagcg
gaagagacgtgggcttacgatgtcggctttctcaataagaagatgatcgaaaaacacgga
ctgtttccgggacaagagagctccacgcaatttttcatgtgcggaccaccgcccatgatc
aagtttgcctgtttgccggccttacaggaactgggattctcggaaaaggattgggtaata
ttctag

DBGET integrated database retrieval system