KEGG   Phaeodactylum tricornutum: PHATRDRAFT_1690Help
Entry
PHATRDRAFT_1690   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pti  Phaeodactylum tricornutum
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PHATRDRAFT_1690
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHATRDRAFT_1690
   00670 One carbon pool by folate
    PHATRDRAFT_1690
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PHATRDRAFT_1690
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PHATRDRAFT_1690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 495 aa AA seqDB search
VVAAAASHRGIGYQGSLPWRLPGDLRHFQAVTTQPPETGGTNAVIMGRKTWDSIPDRFRP
LPGRINVVLTRHPERTLWPDGVLTATSLADAAALLAQPTRAVGHVFVIGGGQVYEQALRE
KFVNRVVYTEVANLPADSKFDAFFPPLPDAEWQAQPWQTSTTATNKENGNAPETGAWHTD
GPSGITYRFLEYTRKVASVTVQPPTDGNAEERQYLDLCRHILDHGVRRGDRTGTGTLSQF
GTQMRFSLRDGTLPLLTTKRVFWRGVAEELLWFVAGNTNANDLAAKDIRIWDGNGSRDFL
DSRGLGHREVGDLGPVYGFQWRHFGATYGTMHDDYTGKGVDQLAECIDKIKNNPEDRRII
LSAWNPADLELMALPPCHMFCQFYVRTASLSCQMYQRSADMGLGVPFNIASYALLTHMIA
HVTGRKPGDFVHTIGDAHVYLNHVDALQTQLERTPRAFPKLQINPDKQNIDDFVFADFTV
VGYQPHKTIKMEMAV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtcgtggcggcggcagcctcacatcgaggcattggctatcaaggttccctgccttggcga
ttaccgggagacctccgtcacttccaggccgtcacgacgcaacctccggaaacgggaggc
accaacgccgtcattatgggtcgcaaaacgtgggacagcattccggaccgtttccgcccg
ctgccgggacgcatcaacgtcgtgttgacgcgtcaccccgaacgtaccctgtggcccgac
ggtgtcctcacagccacgtcgctcgccgatgctgccgcactgctcgcgcaacccacacga
gccgtcggacacgtgttcgtcatcggtggcggacaagtctacgagcaggctttgcgagag
aaattcgtcaatcgcgtcgtttacactgaagtcgccaacctgcccgccgactccaaattt
gacgcctttttccctccattgcccgacgcggaatggcaagcgcaaccctggcagacttct
accaccgcgaccaacaaggaaaacggtaacgctcccgagaccggagcgtggcacacggac
gggccttcggggatcacctaccgctttctcgaatacacccgcaaggttgcttccgtaacc
gtacagccacccaccgacggtaatgcggaagaacgacagtatcttgatctctgtcgacac
attttggatcacggcgtgcgtcgtggagatcgcaccggcaccggcacccttagtcagttc
gggacacaaatgcgcttttccctacgggacgggactctccccctcctcactaccaaacgt
gtcttctggagaggcgtcgctgaagaactcctctggttcgttgcgggcaataccaacgcc
aacgatttggccgccaaagatattcgcatttgggacgggaacggttcacgtgactttctc
gacagtcggggattggggcatcgagaagtgggcgatttgggacccgtctacggcttccag
tggcgccatttcggtgccacctacgggaccatgcacgacgattataccggaaagggcgtg
gatcagttggccgaatgcatcgacaagatcaagaacaatcccgaagaccgacgtattatc
ttgtcggcctggaatcctgctgatctcgaactcatggcgctcccgccctgccacatgttt
tgtcaattttacgtacgtacggcgagtttgtcctgtcaaatgtaccaacgcagtgccgac
atgggtctcggggtgccgttcaacattgcgtcgtacgctttactcacgcacatgatagcc
catgtgacgggacgcaagcctggcgatttcgttcacaccattggcgacgcgcacgtttac
ctcaatcacgtggatgcgttgcaaacacagttggagcgcaccccccgggcctttcccaaa
ctacaaatcaacccggataagcaaaacattgacgatttcgtctttgcagactttaccgtc
gttgggtaccaaccgcacaaaactatcaaaatggaaatggcggtg

DBGET integrated database retrieval system