KEGG   Phaeodactylum tricornutum: PHATRDRAFT_1690Help
Entry
PHATRDRAFT_1690   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pti  Phaeodactylum tricornutum
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pti00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pti00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pti00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 495 aa AA seqDB search
VVAAAASHRGIGYQGSLPWRLPGDLRHFQAVTTQPPETGGTNAVIMGRKTWDSIPDRFRP
LPGRINVVLTRHPERTLWPDGVLTATSLADAAALLAQPTRAVGHVFVIGGGQVYEQALRE
KFVNRVVYTEVANLPADSKFDAFFPPLPDAEWQAQPWQTSTTATNKENGNAPETGAWHTD
GPSGITYRFLEYTRKVASVTVQPPTDGNAEERQYLDLCRHILDHGVRRGDRTGTGTLSQF
GTQMRFSLRDGTLPLLTTKRVFWRGVAEELLWFVAGNTNANDLAAKDIRIWDGNGSRDFL
DSRGLGHREVGDLGPVYGFQWRHFGATYGTMHDDYTGKGVDQLAECIDKIKNNPEDRRII
LSAWNPADLELMALPPCHMFCQFYVRTASLSCQMYQRSADMGLGVPFNIASYALLTHMIA
HVTGRKPGDFVHTIGDAHVYLNHVDALQTQLERTPRAFPKLQINPDKQNIDDFVFADFTV
VGYQPHKTIKMEMAV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtcgtggcggcggcagcctcacatcgaggcattggctatcaaggttccctgccttggcga
ttaccgggagacctccgtcacttccaggccgtcacgacgcaacctccggaaacgggaggc
accaacgccgtcattatgggtcgcaaaacgtgggacagcattccggaccgtttccgcccg
ctgccgggacgcatcaacgtcgtgttgacgcgtcaccccgaacgtaccctgtggcccgac
ggtgtcctcacagccacgtcgctcgccgatgctgccgcactgctcgcgcaacccacacga
gccgtcggacacgtgttcgtcatcggtggcggacaagtctacgagcaggctttgcgagag
aaattcgtcaatcgcgtcgtttacactgaagtcgccaacctgcccgccgactccaaattt
gacgcctttttccctccattgcccgacgcggaatggcaagcgcaaccctggcagacttct
accaccgcgaccaacaaggaaaacggtaacgctcccgagaccggagcgtggcacacggac
gggccttcggggatcacctaccgctttctcgaatacacccgcaaggttgcttccgtaacc
gtacagccacccaccgacggtaatgcggaagaacgacagtatcttgatctctgtcgacac
attttggatcacggcgtgcgtcgtggagatcgcaccggcaccggcacccttagtcagttc
gggacacaaatgcgcttttccctacgggacgggactctccccctcctcactaccaaacgt
gtcttctggagaggcgtcgctgaagaactcctctggttcgttgcgggcaataccaacgcc
aacgatttggccgccaaagatattcgcatttgggacgggaacggttcacgtgactttctc
gacagtcggggattggggcatcgagaagtgggcgatttgggacccgtctacggcttccag
tggcgccatttcggtgccacctacgggaccatgcacgacgattataccggaaagggcgtg
gatcagttggccgaatgcatcgacaagatcaagaacaatcccgaagaccgacgtattatc
ttgtcggcctggaatcctgctgatctcgaactcatggcgctcccgccctgccacatgttt
tgtcaattttacgtacgtacggcgagtttgtcctgtcaaatgtaccaacgcagtgccgac
atgggtctcggggtgccgttcaacattgcgtcgtacgctttactcacgcacatgatagcc
catgtgacgggacgcaagcctggcgatttcgttcacaccattggcgacgcgcacgtttac
ctcaatcacgtggatgcgttgcaaacacagttggagcgcaccccccgggcctttcccaaa
ctacaaatcaacccggataagcaaaacattgacgatttcgtctttgcagactttaccgtc
gttgggtaccaaccgcacaaaactatcaaaatggaaatggcggtg

DBGET integrated database retrieval system