KEGG   Phaeodactylum tricornutum: PHATRDRAFT_17044Help
Entry
PHATRDRAFT_17044  CDS       T01075                                 

Gene name
DET2
Definition
de-etiolated 2 like protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     PHATRDRAFT_17044 (DET2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
31
AA seq 242 aa AA seqDB search
VLLFVIPSPYGKTLRTDWYLGPHLPARACWFLFETPNLIWCAVGLGQRMASRQSPHAAPG
WPPWPNFILLVLFTLHYTQRTILYPLRMTTQSQPIPALVAALAIFFTTINGYLQVSGLLE
FHHLPPGYGTNPVFGAGVCLFLYGASINLQSDATLRRLKAQGKGYQIPRGGWFERLSAPH
YFGELLEWTGFGIAARGSLATVAFVIFTAANLIPRGVAHHAWYRSKFPDYPRRRYAVLPG
TW
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtactgcttttcgtaattccctcgccgtacggcaaaactctgcggactgattggtatttg
ggaccacatctgcctgcccgagcctgctggtttctcttcgaaactcctaatctgatttgg
tgtgccgtgggtcttggacaaaggatggcgtctcgacagtcaccccacgcagcgcctgga
tggccaccatggcccaactttattttactcgtcctcttcaccctccactacacgcaacgc
actatcctatacccgctacgtatgactacccaaagccaacccatccctgcattagtagct
gctttggcgattttcttcaccaccatcaacggctacctccaagtcagtggactgctcgag
ttccatcaccttccacccggatacggaaccaaccccgtcttcggcgccggagtctgtctc
tttctctacggcgcctccatcaatttacaatcggacgctacgttacgccgactgaaagct
caaggaaaaggctaccaaattcctcgtggcggctggttcgagcgcctgtcggctccccac
tattttggagagctgctggaatggaccggattcgggatcgccgctcgcggatccctcgct
accgtcgcctttgtgatctttacagcggccaatctgatccctcggggagttgcgcaccac
gcatggtaccgatccaagttccccgactatcctcggcgccgatacgctgtgctaccggga
acttggtga

DBGET integrated database retrieval system