KEGG   Phaeodactylum tricornutum: PHATRDRAFT_17401Help
Entry
PHATRDRAFT_17401  CDS       T01075                                 

Gene name
DHLTA_1
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_17401 (DHLTA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_17401 (DHLTA_1)
   00020 Citrate cycle (TCA cycle)
    PHATRDRAFT_17401 (DHLTA_1)
   00620 Pyruvate metabolism
    PHATRDRAFT_17401 (DHLTA_1)
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PHATRDRAFT_17401 (DHLTA_1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 492 aa AA seqDB search
MASRTLCQRTWLLASKRPAAWSNSVGRSTGRAPSLELLGGYPVRFFSSYPPHELVGLPSL
SPTMESGSIAAWNLKEGESFIAGDIFCSVETDKATVDFEAQDDGVLAKILAQAGPDEIKC
GDPIMITIEDEAHLGAFADYTLDSGTESSPPVADAAPTPTASPPSPKSSPAENKGTPDGT
TSATSPDTGDRIVASPLAHMLAKEMGYNISKIPGTGPNGRIIAADVKEYTPGAVEDADTV
DTPAPAQAAMKSSPAQPVSGSGYTDYPLSESAREVAARLAQAKRNVPHYYLTVDIAVDEL
LKIRSTLNATLDESAALGVYELLLKAAALSMKAVPSANASWMDSVVRVYDSVDINVVVGS
GDSLVTPVIQNCSSKGLKAISEELGSAVKALEEDDDAPIGGLGTFTVMNLGMYGVKSCAP
IIREPQACALAIGALETRIVPNDDPDAEDIYKESVMFTATLSCDHRVVDGAVGAQWLQAF
KSHVQNPTTLLL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttcccgaacgctctgccaacgtacttggctgttggcgagcaaacgtccggcagct
tggtcgaattcggtgggaagatctaccggtagagcgccttcgctggagcttttgggaggc
tatccagtgcgcttcttctcgagttatccacctcatgagttagtaggtctaccaagtctc
tcaccgacgatggaatccggatccatcgccgcttggaatctcaaagaaggcgagtccttc
attgctggtgatattttctgcagtgtagaaacggacaaggcaaccgtagactttgaagca
caggacgatggagtgttggcaaagattctggcacaagccgggcccgacgaaatcaagtgc
ggcgatcccattatgatcaccatcgaagacgaagcccatcttggggcctttgccgactac
acactcgactcaggaacagagtcatcaccaccagtagcggatgctgccccgaccccaacc
gcatcacccccctctccgaaatcttcaccggccgagaacaagggtactccggatgggacg
acgtccgccacgtcaccagatacgggtgatcgtatcgtggcgtctcctctggcccatatg
ctggcgaaggaaatgggctacaatatttccaagatcccaggcaccgggccaaatgggcga
attattgcggcggacgtgaaagagtacaccccgggtgccgtggaagatgctgatacagtc
gacacgccggcacccgctcaggcggccatgaaaagctccccggcgcagcctgtttccgga
tcgggatacacggattatcccttgtccgaatcggccagagaagttgccgcacgtttggct
caagcgaaacgcaacgtgccgcactactatctaactgtagatattgcggtcgacgagctc
ttgaaaattcggtcgactttgaacgccaccttggatgagagtgccgcgctcggagtatac
gagctcttgcttaaagccgcagcgctttccatgaaggcggtaccctccgcaaatgcttcc
tggatggacagtgtcgtgcgtgtgtacgattcggtagatattaatgttgttgtgggtagt
ggtgattcgctcgtgactcccgttattcaaaattgctccagtaaaggtctcaaagcgatt
tcggaagaactcggttctgcggtaaaagccttggaagaggatgacgatgcgcctattggt
ggcctcggaacgttcacggttatgaaccttggtatgtacggcgtaaagtcttgtgccccg
attattcgggaacctcaagcctgcgccctggcgattggtgctttggaaacacgaattgtt
cctaacgacgaccccgatgcggaagatatttacaaggaaagtgtcatgtttacagcgaca
ctcagctgtgatcatagagtggtcgatggagccgttggagcgcaatggctacaggccttc
aagtcacacgttcaaaatccaaccacactcttactctga

DBGET integrated database retrieval system