KEGG   Phaeodactylum tricornutum: PHATRDRAFT_18008Help
Entry
PHATRDRAFT_18008  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHATRDRAFT_18008
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATRDRAFT_18008
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PHATRDRAFT_18008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 844 aa AA seqDB search
METITELATLANVASPSDVVWNEECAYTFHSPYTTDQGIVVDLNTFVGTCQEMALTTSSR
GIFVRIVKRRQRKENKAGALETVSVEAPTKLALGVEGGFTTEEDQFETVCTTSVVVLEKV
GSLVQIAAEIPYTEESKGTFPTMVAISVDSILNHAGNMLRQDVKTWQLDQDDIQVSKYAE
NLPFVDNGVEISPDPKSWKCESSGATENLWLNLSDGYIGGGRKNWDGSGGSNGALDHFKE
SATQYPLVVKLGTITADLETADCYSYAPDEDGPVRIPNLAGLLEKRGIKVSAMQKTVKST
AELEVELNANYAFDAITEAGANLTPVSGPGLQGLQNLGNSCYLNSVMQVLMAVPELSKRY
GTSPGGSLTQHNLLQNVPPKEAAGNLLTQTTKLASALTSGLFAHPIAEEIGPDANAMVTD
PKYRLAPRMLKNVVGKNHVDFCTGQQQDAAQFLQYYLELLELQERKASARLTKGDGPLYT
TSHLFGFRTTSRLECQADQAVKYKDSATETIWSLRIPMEKAVPKPVPRLSIEACLDSWAS
ETTIDGLQWSHLGNAKHSATQKTRLTNFPRYIVLQAQRYTLGPDWSPIKLEVSLDVPDEM
DLSKYKFLGPLPSDRVVPAESADTEAKTADGPTTPAVDEAALAQLMDMGFSLNSCKRALT
AVGGNNIEAAMGWVFEHNTDSDFNDPLPDVGTDVSPEIGKAVAESAVQSLADSLGCFSVD
QVRVALEETNGAPDRAADWLFSHMDDLEGAISALKKNRAPVEPVGSEESVSLEDGPGFYR
LTGLISHIGKNTGSGHYVAHLKKGDKWIIFNDEKVAVSEHPPKEHAYLYLLQRTDTIDSP
HESY
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccataaccgaactcgcaacgttagccaacgtcgcttcgccaagcgatgttgtg
tggaacgaggaatgcgcctacacgttccactcgccgtacacgaccgatcaaggtatcgtg
gtagatctgaataccttcgttgggacgtgtcaagaaatggcgctgaccaccagctctcga
ggaattttcgtgcgcattgtcaaaagaaggcaacgcaaagaaaataaagccggagcattg
gaaactgtctccgtagaagcaccaacaaaactagctttgggcgtggagggaggctttacg
accgaagaagatcagttcgagaccgtttgtacaacttccgttgtcgttctggaaaaagtt
ggcagcctggtacagattgcagccgaaatcccctacacggaagaatccaaggggactttc
cccactatggtggccatcagtgtagattccatcctcaatcacgccggcaatatgttgcga
caggatgtcaaaacctggcaattggatcaagatgatattcaggtgtcgaagtacgccgaa
aacctcccttttgttgacaacggggtcgaaataagcccagatccaaaatcgtggaaatgt
gagtcttcgggggcgaccgaaaatttgtggctcaacctttccgacggctatattggcgga
gggcgcaaaaactgggacggatcgggtggatccaacggtgccttggatcattttaaggaa
tctgctacgcagtatccactcgttgtcaagctaggaacgatcacggccgatttggaaacc
gcggattgttactcttatgctcccgacgaagacggacccgtcaggattccgaatctagcc
ggcctgctagaaaagcgtggaatcaaagtttctgccatgcaaaagacggtgaaatcgaca
gcagagttagaggtagagctaaacgccaattacgcctttgacgcgatcaccgaggcagga
gcgaacttgacaccggtgtcggggccgggtttgcaaggtttgcaaaatttgggaaactca
tgctatcttaattcggtgatgcaggtcttaatggccgttcccgagcttagcaagcgctac
ggcacatctccaggtgggagcctcacgcagcacaacttattgcaaaatgtccctcccaag
gaagcagcaggtaatttgcttactcagacaaccaagctggccagcgcattgacttcgggt
ctctttgcccatcccatagccgaggaaatagggccagatgcgaatgctatggtcacagac
ccaaagtaccgattggctccacgaatgctaaagaacgttgttgggaagaatcacgtcgac
ttttgtaccgggcagcagcaagatgcggctcaatttcttcaatactacctggaactcttg
gagcttcaggaaaggaaagcttcggcgcgtttgaccaagggagacggtcctttgtatacg
acgtctcacttattcgggtttcgcacgacgtcacgtctggaatgtcaagctgatcaggca
gtaaaatataaggatagtgcaaccgaaactatttggagcctgaggattcccatggagaaa
gcagttccgaaaccggttcctcgcctgtcgattgaagcttgcttggactcttgggcatcg
gaaactactattgacggtttacaatggtcccatttgggaaatgcaaagcattccgctacc
cagaaaacacgcttgacgaactttccgcgatacatcgtgttgcaggcgcaacgatacaca
ctcggaccagattggagtccgatcaaattggaagttagtctcgacgttccggacgagatg
gatctgtccaagtacaaattccttggccctttaccaagcgaccgtgtggtaccggcagag
tccgcagacaccgaagcgaagacagcggatggtcctactaccccggccgttgacgaagct
gccttagcacaattgatggacatgggattctcactgaacagttgtaagcgtgcgctgacc
gctgtcggtgggaacaatatagaagcagccatgggttgggtgtttgagcacaacacggac
tcagattttaacgacccgttgccagacgttggaactgatgtatctccagaaattggtaaa
gctgtggctgaaagtgctgtccagtcactggcggatagtttaggctgtttttctgttgat
caagtccgagtagctttggaagagactaacggggcgcctgatcgagctgcggactggttg
ttttcccacatggacgacttggaaggtgctatttccgccttgaagaaaaacagggcaccc
gttgagcctgtggggtctgaggaaagtgtttcgctagaagacggaccaggtttttacagg
ttgacgggattgatttcgcatatcggaaagaacactggcagtggtcactatgtggctcac
ttgaagaaaggagacaagtggattatctttaacgacgaaaaggttgctgtctctgagcat
ccaccgaaggagcatgcatacttgtatctactgcagcgtacggataccatcgacagtccg
cacgagagctattag

DBGET integrated database retrieval system