KEGG   Phaeodactylum tricornutum: PHATRDRAFT_18337Help
Entry
PHATRDRAFT_18337  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pti  Phaeodactylum tricornutum
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PHATRDRAFT_18337
Enzymes [BR:pti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PHATRDRAFT_18337
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C44
   PHATRDRAFT_18337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 596 aa AA seqDB search
MCGIFAIFSSSLPESDLRRELISCSSRLRHRGPDWSGYKVIEANVEAGIPLSHGIAHERL
AIMDPESGSQPLVSHDGSLIVAANGEIYNYKELYETLETPYKAKTGSDCEVILPLYEQFG
ASIEIPRLLRGMFSFILYDRHNDSFMIVRDHLGITPLYIGWANDGSVYVASEMKSLVGHC
SKFQNFPPGHIFCSKGEHAGEFQRWFNPSWAPEMKPGVPLPKQPYQADVLRHAFERAVVR
RMMSDVPWGVLLSGGLDSSLVAAICARHIGRRSASFPKLHSFTIGLEGSPDIIAAKKVAD
YLGTIHHAYTYTIQEGADAVRDVIRALETYDLTTVRASTPMYLMSRKIKAMGIKMVLSGE
GADEVFGGYLYFHKAPNAQEFMDETIDKLSRLHMYDCLRCNKAMSAWGVEPRVPFLDADF
LEVAMNLDPEEKMIRLGEDVPKEDRRAEKWCIRKAFDTPDDPYLPDDILWRQKEQFSDGV
GYGWVDHLKEVAEQEVSDQMFAAAKNRFPHNTPTTKEGYRYRMIFEEIFPGEAPEKTVPG
GKSIACSTERAMQWDASFASRADPSGRSAGVHSAAYDEAFEADTKVSEPAIKKAKA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatctttgccattttctcctctagccttccggaaagcgacctgcgacgcgag
ctgatttcctgttcttcgcggttgcgtcatcgtggtccggactggtcgggttacaaggta
atcgaggccaatgtcgaagctggcattccgctttcgcacggtatcgcccacgaaagactc
gctattatggatcctgagtccggatcgcaaccgctagtttcgcacgacgggtccttaatc
gtcgccgctaacggagaaatctacaactacaaggaactctacgagacgctcgagacgcct
tacaaggccaagacggggtcggactgtgaagtcattttacctctctacgagcagtttggt
gcatccatcgaaattcctcggttgctgcgaggaatgttttcctttatcttatacgatcgc
cacaatgattcctttatgattgttcgtgatcatctcggtattacaccactctatattgga
tgggcgaacgatggatccgtgtacgtggcttccgagatgaaaagtttggtagggcattgc
agcaagttccagaactttcctccaggacacattttctgtagcaagggagaacatgcgggc
gaattccaacggtggttcaacccatcgtgggctcccgaaatgaagccgggcgtccccctg
ccgaagcaaccatatcaagcggatgttctccgtcatgcatttgaacgtgccgtcgttcgt
cgtatgatgtcagatgtcccctggggagttcttttgtcgggaggccttgatagttcattg
gtggctgccatttgtgcacgccacattggtcgccgcagtgcatcctttcccaaacttcac
tcgtttaccataggtttggaaggttcacccgacattattgccgcgaagaaggtcgctgac
tacttgggaaccattcatcacgcttacacgtacaccattcaggaaggtgccgatgctgtg
cgagacgtcatcagggcgctcgaaacatatgacctcaccacggtccgagcgtcgacgcca
atgtatttgatgagccgtaagatcaaagccatgggcattaagatggttttgtctggagaa
ggcgctgacgaagtctttggtgggtacctttattttcacaaagcgcccaacgcgcaggag
ttcatggacgagacgattgacaaactcagccgtttgcatatgtatgattgcttgcgttgc
aacaaagcaatgagtgcttggggtgtcgaaccgcgtgtaccttttctagatgctgacttt
ttggaagtggccatgaacctcgatccggaagaaaagatgatccgtctcggtgaagatgtt
ccaaaggaggaccgtcgtgccgaaaagtggtgtatccgtaaggcgttcgacaccccggac
gatccttacttgcctgatgacatcttgtggcgtcaaaaggaacaatttagtgacggcgtc
ggctatggctgggttgatcatttgaaggaagttgcggagcaggaggtgtctgaccagatg
tttgcagctgcaaaaaatcgctttccccacaacacgcctacgaccaaggaaggataccgc
tatcgcatgatctttgaggagattttcccgggcgaagcgccggaaaagaccgttccagga
ggcaaatcgatcgcttgctcaactgaacgtgctatgcagtgggatgcttctttcgcgtct
cgggctgatcctagtggacgttctgcaggagtccacagtgcagcgtacgacgaagccttt
gaggcggataccaaagttagcgagcccgctatcaagaaggctaaagcgtag

DBGET integrated database retrieval system