KEGG   Phaeodactylum tricornutum: PHATRDRAFT_18899Help
Entry
PHATRDRAFT_18899  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
pti  Phaeodactylum tricornutum
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:pti03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 327 aa AA seqDB search
MPATQNGQDEKWIDNMIELLLSARNKKPGTPVDISVQDATQLCTQARDVFMSQPMLLELG
APIKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLEVVCLLFAYKIKYPE
NFFLLRGNHECAGINRIYGFYDECRRRFSVKMWKQFCNTFNCLPCTAVIDDKIICMHGGL
SPELSQMEQIANIARPCDVPDTGLLCDILWADPDPSITGWGENDRGVSFTFGGDVVRQFL
RRHDLDLVVRAHQVVEDGYEFFAGRELVTVFSAPNYCGEFDNAGAMMTVDDTLMCSFQIL
KPASAAQQRSAFGSGRTGTPGRGAGGR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccggctactcaaaatggacaagacgagaagtggatcgacaacatgattgagctgctc
ttatcggcccggaacaaaaagccgggcacaccggtcgacatttccgttcaggacgccact
cagctctgtacgcaggccagggacgtctttatgagtcaacccatgctgctggagcttggt
gcacctatcaaaatttgtggcgatatccacggacagtatacggacttactacgccttttc
gagtacggtggatttcctcccgaagcaaattacctttttttgggagactacgtggatcgg
ggcaagcaatcgctcgaggttgtttgcctgctctttgcctacaaaatcaaatatccggaa
aactttttcctgttgcgcggcaaccatgaatgcgccggcatcaaccgcatttacggattc
tacgacgaatgccgtcgtcgcttttctgtcaaaatgtggaagcaattttgcaacaccttt
aactgcttgccctgtacggcggtgattgacgacaagattatttgtatgcacggcggtctt
tctcccgagttaagtcaaatggagcaaattgctaatattgcgcgtccgtgtgacgtgccc
gataccggactcctgtgtgatatactttgggccgaccctgatcctagtattacgggatgg
ggcgagaatgaccgtggcgtatcgttcacctttggtggcgacgttgttcgccagttcctt
cgtcgacacgacttggatttggtcgtacgagcacatcaagtagtagaggacggatacgaa
ttttttgccggtcgagaacttgtgacagtattttcggctccgaattattgtggagagttt
gacaatgccggagccatgatgaccgtggacgatacgctgatgtgctcgttccagattttg
aaaccagcgagtgctgcacagcagcgtagtgcctttggtagtggacgtacgggaacgccc
gggcgaggagccggcggccgatga

DBGET integrated database retrieval system