KEGG   Phaeodactylum tricornutum: PHATRDRAFT_21660Help
Entry
PHATRDRAFT_21660  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
pti  Phaeodactylum tricornutum
Brite
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   PHATRDRAFT_21660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 2400 aa AA seqDB search
MANQRAAAELASLLWTLAHEMSVEDFGAVESEVFTLVFALVHAPDKESRMAGLAALDGLL
VAPSADEEKKAIKFANALSTGLRAANGDYEFFSAVSKALGHMAMRISNVDFVEAEVTRAL
EWLRTGRSDRSLLRLRRLAASLSLKEFAIHAPTTFHSKTSQSTLGQGGSNEFLDTIFQSI
RDPQPIVRVCAADALSQCLRILVDRRHLSLTGLLCQIHFSTMEGLQEATKKQSWHAASES
EAAKHGSLLVVGTMLAYTREFLLPRFEEICRAVLACSKNPKVLIRLEVVRLIPKLAACCS
SVFGRRYLEQSLVFLIDNVSSPASLRDNVDIRPSVYDAIGDLIMAMSDENTGRRLEEIFA
VVRKGLHAPTSRSSVGHTLCPALHCASSLVEALKDLALPYLDGVIDDMFQSGLSIDLIQC
LHSIAQSIPMYKDEIEDRMLQEVSLSLAGNRRSSDHTLGSSYPAGAASTTESSNVHINMN
NDAKTTKLLVLSLQTFASFSNSTAQVTLSGKIIPLMPFVQDVTARYLLHPSNEVRRAAAL
ACCVLLIPHGSIFASAGSCSGLIIEDVLEALLRAAVSDSSAVVRLCVVRALDTRYDPFLC
QTHHLQDLFLVLQDETLATRVAGLQLLGRLASLNPAPILPVLRRFLNDLVVELQCGVDTG
RGREEATRLLVVFLRVKPLQRLIHPVLATLVGALPLTGAAPPRLASASLEALGELAQATG
TALQPWVNDIIPHVLNTMKDQSSASKQRTSLRTLGQIAGSTGYVVRLYLDYPNLLSQATD
ILPATKRAPWTLRREVIRTLGIIGALDPDRYYSVASKARKGGVQYAMVAQPVSNLSPAKR
MTPSEEDFYPTVSIQALMRIFRDSTLTVHHGMVIQAIMFIFKSLGVRCVPFLGKVLPHMI
LTIRHCPSNLKESLFIQLSNLTLVVKAHLRIFVDDIFDIVEQFWDSRHLSIILKLLSNIA
IGVPDAFRQFVPRFIRRLLTSLDELQVADWSTAKQSLLPQNGRAESEKLSHILKSISKLN
SMLREYLHILIPALLKLADSLASLSFNGATTTTISILDGFSVLNCRTLSALIESQAPAPN
PVALALFTGLSCTPPINSENGLPSRVVQPLVRIFRETPPRSLAVGLSMVETLFDEHPVAP
ALRASFSVSNRQKVNQGNLQRAWDVSQRSSREDWDEWMRRFAIQLLREAPSPALRASANL
AHAYQPLARELFSAAFACCWKELSHPYRTDLLSALETAFVADISPEILLALLNLAEFMEH
DPSGGLPIDISILADLALKCRAYAKALHYKEREYRNGGSGSCVEALISINRKLDLQEGAL
GILKASAIDDEDASKQSGWWLAKLGNWTEALEVYREKLKSDPHDFEAIVGCMRCLDASGE
WRKVLDLAEQNWTALSQHRCIVRMCAQAAWRLGQWDDLEKYSSQLTCVGFDGAFYSAVLH
VHRQDWSHAADAIDAARKAMDSRFTALLAESYSRAYPSMVTAQMLSEMEEIIEYMKTEER
SRIEIDHHPANRQSIERARERLISVWKDRLAGCRMDSEAHASILAVRSLVIGPEDDVDAV
LTLSKLSRQAERHKFAERVLLDPLHSLKIQHTFYFAYVKHLWYTGEKHEATRRLEHLCDV
VDMVSHCERINETSLRVACWLEYGEWKLSTTTSLGSSMSPQFQLDVLTSLKRATQPDDCG
YKAWHGWSLLNFRIALQLNDRHHLSSQADAQRPGASFDKSIRNHVVAAVRGFVNAINLGT
IKQSASVQQDLLNLLTCLFKFGSLQDVAVVLNECVSSVAIEAWLGVLPQLLARIHIKDPA
IRSVLHPLLTRLGEKHPQALMYQLSVLLKSPVVERRTAAESLMNSLKSHSSDLVEESLMV
SSELIRVAILWSETWHAGLENASAFFYVENNIAAMLDQLHSLHGEFEKEPETSMERDFAE
AHGGNIRQAYDCIKKYIQLSSNDDENLSPEQKDSRREEAETFLHKAWDSYYVVFRPINQD
LKSMSLLRLPECSPALSRARNLELGVPGSYRVDGSYVRIQKFVQRVSIINSKQRPRKVTL
RGSDGKHYVFLLKGHEDLRQDERVMQLFGLVNALLVRDPQTKNQDLMIKRYTISPLSHNC
GLVGWVPHCDTMHALIRDYREAKKVPMNIENREMMKTAPDYDLLTGMQKVEVFTDALQKT
PGKGDDLAEIFWLKSTNSEEWLERRTKYTRSLAVMSMVGYILGLGDRHPSNLMIDKLSGR
VLHIDFGDCFEIAMVRDKYPERVPFRLTRMLVKAMEVSGIEGTYRSTCERTMNLLRSSRD
TLVAMLEAFVHDPLISWRLVNFITGGASARVATETSIARSRMERSLMGVMGGENGVVHEE
ALNVKALQVIRRVEDKLSGTDFPDCEGEPLDVSDQVQRLIVQATSSENLCQLFIGWCAFW
NT seq 7203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcagcgggcagctgcagagttggcatctctgctttggacgcttgcgcacgaa
atgagtgtggaagattttggtgccgttgaaagcgaagtttttacgctcgtgttcgctctc
gtgcacgctccggacaaagaaagtcgtatggccggtttggccgccttggatggattgttg
gtggcaccgagtgcggacgaagagaaaaaggccatcaagttcgctaacgccttgagtaca
gggctgcgagcagcgaatggcgactatgaatttttttccgccgtgtcgaaagcgctgggt
catatggcgatgcgcatttcgaacgtggattttgtcgaggccgaagttacccgagcgctg
gaatggttgcgcaccggacgttcagatagaagcctgcttcgtctacgaagactcgcggcc
tctttgtcactcaaagaatttgcaatccacgctcctaccacctttcattctaagaccagt
caatcgacgctaggacagggcggttccaacgagtttttggataccatttttcagtcaata
cgtgatccacaacccatcgtgcgagtctgtgctgctgacgctctttcacaatgtttgcgc
attttggtagatcgtagacatctttctctaactggactattgtgtcagattcacttctct
acaatggaaggtcttcaagaagcgaccaagaagcaatcttggcacgcggcttcggaatct
gaagcagccaagcacgggtcgctcttagtagtcggaacaatgctggcgtacactcgcgaa
ttcctactgcctcgtttcgaagaaatatgtcgagcagtcttagcttgctccaaaaaccca
aaagttttgatccgtttggaggtcgttcggttgattcctaagttagctgcttgctgctct
agtgtgtttggccgccggtatttggagcaaagcttagtctttttgattgacaacgtatct
agcccagcatctctccgcgacaacgtcgatatacgtccttccgtctatgacgctattggc
gatttgattatggcaatgagcgatgagaatactggaaggaggctggaggaaatcttcgcc
gttgttcggaaagggctgcacgctccaacatctcgaagctctgtcggtcacaccttatgt
ccggcactgcattgcgcctcaagccttgtcgaggcgctgaaagacttggctctgccttat
ttggatggcgttatcgatgacatgttccaatcgggtttgagtattgatttgattcagtgt
ttgcactctatcgctcagagcattccgatgtataaagatgaaattgaagatcgcatgtta
caagaagtatctctgtctctggctgggaatagacgttccagtgatcatactcttggatcg
agctatcctgcgggtgcagcctcaactactgagtcttcgaatgtgcatattaatatgaac
aatgatgcaaaaacgaccaaattgttggtcctgagtcttcagactttcgcatcattttca
aactcgacggcccaagtgactttgtctgggaagattattccgcttatgcctttcgttcaa
gatgttacagcacgatatctattgcacccatcgaacgaggtacgccgggcggcagcgctg
gcatgctgcgtcctgctgattccccatggttctatctttgccagtgctgggagctgcagt
ggtttaattatagaggatgttctggaagctcttctgagagctgccgtttcggatagctct
gctgttgttcgcctctgcgttgttcgtgcgttggatacgcgatacgacccttttctgtgt
cagacacaccatctgcaagacctgttccttgtgctacaagatgaaacattggcaacaaga
gttgctggtcttcaattacttggtcgtcttgcaagtctgaatcctgctccaattcttccg
gttctccggaggtttttaaacgatcttgtcgttgaattgcagtgtggagtcgatacggga
agaggccgagaagaagcgacacgcttgctcgtcgtttttctacgcgtgaagcctttgcaa
cggttgattcatccagtacttgctacactcgttggggcacttcctctgacaggtgctgca
ccaccgcgattagcttcggcgtctttggaggcactcggtgagcttgcacaagctacaggt
acagccttgcagccgtgggtcaatgatattattcctcatgttctgaatacaatgaaggac
caaagcagcgccagtaagcagaggactagtctcagaactcttggtcagattgctggctca
actgggtacgttgtccgtctctatcttgactatccgaatcttttaagtcaagcgacagat
atcttgccggccacaaagcgagctccatggactcttcgtcgggaagttatccgtacattg
gggattattggtgctttagatcctgaccggtattattctgtagcttctaaggcccgaaaa
ggaggcgttcaatacgctatggttgcacaacctgtatccaatctttcccctgcgaagcgt
atgacaccatctgaagaagatttctatccgacagtctctatacaggcactgatgcgaatt
tttcgcgactcgacgcttactgtgcatcacggtatggttattcaggcaattatgtttatc
ttcaagtccctgggcgtgcggtgtgttccattcctgggaaaagttctgccccacatgata
ttgacaatacgacactgcccctcgaatctgaaagagtcacttttcattcaactctccaac
ctaaccttggttgtaaaggctcatctgcgaatatttgttgacgacattttcgatattgta
gaacagttttgggactcaagacacctctctattattttgaagttgctctcaaatatagca
attggagtaccggatgcctttaggcaattcgtcccccgcttcattcggcgtctccttaca
tcacttgatgagctacaagttgctgactggtccacagctaaacaaagcttgcttccccaa
aatggtagggccgagtcggaaaagctcagtcatattttgaagagcatttcaaagctcaac
agcatgttaagggaatacttgcacattctgattcccgctctcttgaagcttgctgactca
ctagcttcgttatccttcaacggtgcgacgaccactacgatatctattttggatggcttc
tccgtactgaattgtaggacactgtcagcgctgatagagagccaggcgccggcaccaaat
ccagtcgcactggctctgttcacaggtctaagctgcactccaccgataaactccgaaaat
ggacttccgtctcgcgttgtccagccattggttagaatttttcgagaaacgccaccgcga
agtcttgctgtaggcctatcgatggtggaaacactcttcgatgaacatcccgttgctcct
gctcttcgcgcatctttctcggtctcaaatagacagaaagttaatcaagggaatctgcaa
cgagcctgggatgtatcgcaacgatcatctcgcgaggactgggacgagtggatgaggaga
tttgcaatccagctactacgtgaagcaccatcgccggccctacgagcaagcgcgaatctt
gctcatgcatatcaacctttggcgagagagcttttcagtgctgcatttgcttgctgctgg
aaagaattgagtcatccgtaccggacagacctacttagtgcgctggagaccgccttcgtt
gctgatatttccccggaaattcttttggcgctactaaacctggctgagtttatggaacat
gacccaagtggaggtctccctattgacatttcaatcttggcagatttagcattgaagtgt
cgggcgtacgccaaagcgctgcactacaaagaacgggagtacaggaacggaggatcaggt
tcctgtgtggaagcgctaatcagtatcaatcggaagttggatcttcaagagggtgcgcta
gggattttgaaggcttccgcgattgacgatgaggatgcatccaagcaatcgggttggtgg
ctggccaagcttggcaactggacagaagcgctggaggtatatcgcgagaagctgaagagc
gaccctcacgattttgaagctattgtaggatgcatgaggtgccttgatgcgagcggcgag
tggcgtaaagtgcttgatcttgctgagcaaaattggacagctttgagccagcatcgatgt
atcgtccgaatgtgcgcccaagctgcctggagactaggtcaatgggatgatctcgaaaag
tactcatctcagctgacttgtgtcggatttgatggcgcgttttacagtgcggttttgcat
gttcatcgccaagactggtctcacgccgctgatgctattgatgctgctaggaaagcaatg
gacagtagattcaccgcgttgctggctgaatcatatagtcgggcataccctagcatggtg
acggcccagatgctatcggagatggaagaaattattgagtacatgaaaactgaagagagg
tcaagaatcgaaattgaccatcacccggcaaatcggcagagcatagaaagggctcgggag
aggctaatatctgtttggaaggatcgactagcagggtgccgtatggattctgaagcccac
gcgtcgattcttgcggtcagatcactggtgatcggaccggaagatgacgtagatgccgtg
ctaacgctgagtaaattatcgaggcaggccgaacgccacaagtttgcagaacgcgtttta
ctcgaccctttgcattcgctcaagattcagcatactttttattttgcttatgttaagcat
ttgtggtatactggtgaaaagcatgaagcaaccaggcgtttagagcatctgtgtgatgtt
gtagatatggtctcacattgcgaacggattaatgaaacgtcgctaagagttgcatgttgg
ctggaatacggggagtggaagctgtcaacaacaacttcgcttgggtcatccatgagtccg
caatttcaactagatgtgttgacgtctttgaagcgggcaacccagccggacgactgcggg
tataaagcatggcacgggtggtcgcttttgaactttcgcattgccttgcaactcaacgac
cggcatcatttatcgtcgcaagcggatgctcaacgcccaggcgcaagcttcgataagagt
attcggaatcatgttgttgctgcagtccgagggtttgtgaacgcaatcaacttaggcacc
attaaacagagcgcctcggtgcaacaagatttattgaacttgttgacttgcctcttcaag
tttggcagtttgcaggacgtcgcggttgtcttgaatgaatgcgtgagctccgtcgccatc
gaagcttggctgggcgttcttcctcagctattggctcgaatacatataaaggaccccgcc
ataagatccgtcctgcaccccctgcttacacgtctcggtgagaagcaccctcaagcattg
atgtaccagctttccgttcttctcaaaagccctgtcgttgagcggagaaccgctgcagag
agcttgatgaactcactgaagtcacattcaagtgatctagtggaagagtctctgatggtt
tcatcagagctaatcagggtggcgatcctttggtctgaaacgtggcacgctggactagag
aatgcctcagcgtttttctacgttgaaaataacatagctgcgatgctggaccagctgcac
tctctacatggtgaatttgagaaggagccagaaacgagtatggagagagactttgcggaa
gcccatggaggaaacattcggcaagcatacgactgtattaagaaatacatacagctgagc
tccaacgatgacgagaatttatcgccagagcagaaagactctcgccgtgaagaagccgaa
acttttttacacaaagcttgggattcatactacgttgtctttcgaccgatcaaccaggat
ctgaaatcgatgtcgcttcttaggctaccagagtgttctccggcgctcagtcgagcccga
aatttggaacttggagtaccaggatcgtatcgcgtcgatggttcctacgtaaggattcag
aagttcgttcagcgcgttagcattatcaatagcaagcagaggccccgtaaagtgacgttg
cgagggagcgacgggaaacactacgtattcctcctcaaaggtcacgaggatctccgtcaa
gatgagcgtgtcatgcagctgtttggtctcgtgaatgcactgttggttcgggacccgcag
acgaagaatcaagatttgatgatcaagcgatacaccatttcgcctttgtcacacaattgc
ggcctcgtcggctgggtgcctcactgcgacactatgcatgcgttgattcgagactatcgc
gaagccaaaaaagttcctatgaacatcgagaatcgagaaatgatgaaaaccgcaccggat
tacgaccttttgacgggaatgcaaaaggtggaagtttttactgatgcgctacaaaaaaca
cctggtaaaggggacgatctggctgaaattttttggctaaagagcacaaacagtgaggaa
tggctcgagcggcgcaccaagtatacgcggagtttggcagtcatgtcgatggtgggctac
attctcggtctcggagatcgccacccttccaatctcatgattgataagctttccggtcgc
gtcttgcacattgatttcggggactgtttcgagattgccatggtgcgcgacaagtaccct
gagcgagttccattccgcctcacgcgtatgctagtcaaagctatggaggtctcgggaatc
gaagggacctaccgcagtacgtgcgaaaggacaatgaaccttcttcgctctagtcgtgat
acgttagtcgctatgcttgaagcgtttgtgcacgaccctctgattagttggcggttggtg
aactttattacagggggtgcgtcggcacgagtggcgacggaaacttccatagcacgatcc
cgcatggagcgatcgcttatgggagtgatgggcggggagaacggggtcgtgcatgaggaa
gcgttgaacgtcaaggctctgcaagttattcgacgagttgaagacaaactgtccggtacg
gactttccggattgcgaaggcgagccgctggatgtgtcagaccaagtccagcggctgatt
gtacaagcgacgagttccgaaaatttatgccagctctttattggatggtgtgcgttttgg
taa

DBGET integrated database retrieval system