KEGG   Phaeodactylum tricornutum: PHATRDRAFT_21868Help
Entry
PHATRDRAFT_21868  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00790  Folate biosynthesis
pti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHATRDRAFT_21868
Enzymes [BR:pti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PHATRDRAFT_21868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 7202713
NCBI-ProteinID: XP_002182104
JGI: 21868
UniProt: B7G4N1
Position
14
AA seq 186 aa AA seqDB search
MSAACKTILECIGEDPHREGLLKTPLRWAKALLYMCQGYDKRPEDVTNGAVFHENHSEMV
VVRNIDIHSLCEHHMVPFTGRVHIGYIPNGKILGLSKLARIAELYARRLQVQERLTRQIA
DAIVETVEPLGVAVVVECTHFCMVMRGVQKTGALTTTSSVRGCFESNSKTRAEFFSIIQG
NGVTMC
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcctgcaaaacgatcctggaatgcataggggaagacccgcaccgcgaaggt
ctcctgaagactcccctacgatgggccaaggctctactctacatgtgccaaggctacgac
aaacgcccggaagacgtcaccaacggcgcagtctttcacgaaaatcactccgaaatggta
gtggtccgcaacattgacattcatagtttgtgcgaacaccacatggtcccttttaccggt
cgcgtccatattggatacattcccaacggcaagattctcggtttgtccaagctcgcccgg
attgccgaattgtacgcccgacgcttgcaggtgcaggaacgattgacacgccaaattgcc
gacgctattgtggaaacggtcgaacccctcggtgtcgccgtagtcgtggagtgcacgcac
ttttgcatggtcatgcggggagtccaaaagacgggagctttgacaacgacgtcgtcggtc
cggggatgcttcgaaagcaattccaagacacgagccgagttcttttccatcattcaaggg
aatggtgttaccatgtgttga

DBGET integrated database retrieval system