KEGG   Phaeodactylum tricornutum: PHATRDRAFT_21868Help
Entry
PHATRDRAFT_21868  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pti  Phaeodactylum tricornutum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHATRDRAFT_21868
Enzymes [BR:pti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PHATRDRAFT_21868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
14
AA seq 186 aa AA seqDB search
MSAACKTILECIGEDPHREGLLKTPLRWAKALLYMCQGYDKRPEDVTNGAVFHENHSEMV
VVRNIDIHSLCEHHMVPFTGRVHIGYIPNGKILGLSKLARIAELYARRLQVQERLTRQIA
DAIVETVEPLGVAVVVECTHFCMVMRGVQKTGALTTTSSVRGCFESNSKTRAEFFSIIQG
NGVTMC
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcctgcaaaacgatcctggaatgcataggggaagacccgcaccgcgaaggt
ctcctgaagactcccctacgatgggccaaggctctactctacatgtgccaaggctacgac
aaacgcccggaagacgtcaccaacggcgcagtctttcacgaaaatcactccgaaatggta
gtggtccgcaacattgacattcatagtttgtgcgaacaccacatggtcccttttaccggt
cgcgtccatattggatacattcccaacggcaagattctcggtttgtccaagctcgcccgg
attgccgaattgtacgcccgacgcttgcaggtgcaggaacgattgacacgccaaattgcc
gacgctattgtggaaacggtcgaacccctcggtgtcgccgtagtcgtggagtgcacgcac
ttttgcatggtcatgcggggagtccaaaagacgggagctttgacaacgacgtcgtcggtc
cggggatgcttcgaaagcaattccaagacacgagccgagttcttttccatcattcaaggg
aatggtgttaccatgtgttga

DBGET integrated database retrieval system