KEGG   Phaeodactylum tricornutum: PHATRDRAFT_22974Help
Entry
PHATRDRAFT_22974  CDS       T01075                                 

Definition
acetate-coa, ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_22974
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_22974
   00620 Pyruvate metabolism
    PHATRDRAFT_22974
   00640 Propanoate metabolism
    PHATRDRAFT_22974
Enzymes [BR:pti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PHATRDRAFT_22974
Lipid biosynthesis proteins [BR:pti01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PHATRDRAFT_22974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
20
AA seq 675 aa AA seqDB search
MTSLNDQESSKGLAAHEIPKLFDPIGKASISLEDYKQAHAESIRDPSAYWSQQAKSYLDW
YVPFDQALTGDFSAGDIAWFAGGKLNVCYNAIDRHVRNGKADQVALVWEGDEPDDIRRLT
YLDMQRKISQIANALHAQGVRRGDVVTIYMPMIPELPMTMLACARMGAMHSVVFAGFSSE
ALAQRISAARSAFVVTADLGKRGGKSIDLKGIVDAARAKIDCEDIITSVMVWERFFDQDS
ETAPYDMQPKDVRMDLLVAGQRPCHVPEWMDAEDGLFLLYTSGSTGTPKGLLHTTGGYAL
YAAFTTKNSFALEDGDLFACVADCGWITGHTYVVYGALLNGATTFVFESTPVYPDPGRYW
DMVERHKITQFYTAPTAIRLLMRYGDHHPAKYDMSSVKVLGTVGEPINPEAWRWYFEAVG
KSKCTIVDTYWQTETGGHIVTNFPGVTPMKPGSCTFPSYGIDTVILDPMSGEPVTEANEK
GHKEGVLAVRQPWPGMARTCLGDHHRFMTTYLKVYEGYYFTGDSAYLDQDGFHWIVGRVD
DVLNVSGHRIGTAEVESALVSHAAVAQAAVVGQPHEIKGQSIAAFVMLTDGFSESESLIK
ELRSLVRQEIGGFAQPDLICATQSLPMTRSGKIMRRILRKIVCNEVESLGDTSTLADPSI
VDELIAKVAELQAAK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgacttctctgaatgatcaagaatcgtcgaaaggtttggcggcgcacgagatcccaaag
ctctttgatcctattggcaaggcttccatttccttggaggactacaagcaggcacatgcc
gagtctataagggacccctccgcctattggtcgcagcaagctaaatcctaccttgattgg
tacgttcctttcgatcaggcattgacgggagacttttctgccggtgacattgcctggttt
gctggcggtaagctcaatgtttgttacaacgcgattgatcgtcacgtgcgcaacggcaag
gctgatcaagtcgccctggtctgggaaggcgacgaaccagatgacatccgtcgtttgacc
tacctcgacatgcaacgcaagatttcacagattgcgaatgctttgcacgctcagggtgtt
cggcgtggcgacgttgtcactatttacatgcccatgattccggaattgcccatgaccatg
ttggcctgtgcccgtatgggagccatgcattcggttgtgtttgccgggttttcctccgaa
gccttggcccagcgcatctcggcggcgcgctcagcctttgtggtcacggccgatctgggc
aaacgcggaggcaagtcgattgatttgaaaggaattgtggatgccgcacgtgccaaaatc
gattgcgaagacattatcacgtcggtcatggtctgggagcgatttttcgaccaagattcc
gaaacagctccctatgatatgcagccaaaggatgtacgcatggatctgctggtagcggga
cagcgaccctgtcacgttcccgagtggatggatgcagaagacggtctctttttgctctat
acaagtggaagtacgggaacacccaagggtctattgcacacgacgggaggctacgcacta
tacgctgcgtttaccaccaagaattcctttgcgttggaagacggtgatttgttcgcgtgt
gtagccgattgcggttggattactggccacacgtacgttgtctacggtgcactattgaac
ggagcaaccactttcgtctttgagtcgacgcccgtctacccggaccctggtcgctactgg
gacatggtcgagcgccacaagattactcaattttacaccgcacctaccgccattcgtttg
ttaatgcggtatggcgatcatcaccccgcgaagtacgatatgtcatccgtcaaggtgctt
ggaactgtcggtgaacccattaaccccgaagcctggcgctggtactttgaagccgtgggc
aagtccaaatgtaccattgtcgatacatactggcagacggagaccggcggacatattgtc
acaaattttcccggtgttacacccatgaagcctggatcttgtacctttccaagttacggt
atagatacggtgattctggatcccatgtccggggagccggtgacggaagcaaacgagaag
ggacacaaggaaggagttttggctgttcgtcaaccgtggcccggcatggcccgtacatgc
ttaggtgaccaccaccgattcatgactacctacttgaaagtgtacgagggctactacttc
actggcgactccgcctatttggaccaagatggtttccactggatcgttgggcgtgtcgat
gacgttttgaacgtttctgggcatcgtattggaacagccgaggtcgaatctgcgttggtt
tctcatgctgcggtcgcgcaagctgctgttgttggacaacctcacgaaatcaaaggccag
tccattgccgcatttgttatgctcacggacggcttttctgaatcggaatcactaatcaag
gaactgcgaagtctagtgcgtcaagaaataggtgggtttgctcaacctgacttaatttgt
gcaacccaaagccttcccatgacacggtctggaaaaatcatgcgtcgtatattgcgcaaa
attgtttgcaatgaagtcgagtccctgggcgacacttctactttggccgacccatcaatc
gtggacgagctcattgccaaggttgccgaactacaagcagccaagtaa

DBGET integrated database retrieval system