KEGG   Phaeodactylum tricornutum: PHATRDRAFT_23850Help
Entry
PHATRDRAFT_23850  CDS       T01075                                 

Gene name
DHLTA_3
Definition
dihydrolipoamide acetyl transferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pti01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pti00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pti00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pti00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
27
AA seq 477 aa AA seqDB search
MKFHTSAALWIAFATASSVDAFRVTSRPSVTLRPWRTALCAEGTKITMPALSSTMKEGRV
VSWLKNEGDEIEAGEAIMVVESDKADMDVEAFEDGVLAKILVPEGAMAPVGEAVALMAEN
AADVASVIASLGAGSSASEPVLDAPAPTSGTYVSPVASTPATTAPASPATAPAAPQAAAP
RPAGERVTASPLARKKAQELGVDLNTITGTGPSGRVTASDIEAAASGTAPPRPSAVAHAA
ANGAPAVELPEGVVPMTGMQRAVSNNMVATLPTPEFRVTREIQMDAFDALYQKLKPNGIT
VSAMLAKAVALAIEKHPIINSSFSEEGGGSIVYKKDINIAMAVAIDGGLITPVLQYANER
SVVELGENWKELVGKAKSGTLAPAEYNSGTFAISNMGMFGVTHFGAILPKGIGGILAIGA
TQEMIVPDQSAILGMKKVKKMSVTLTCDHRQIYGADAALFLKTLADIMENQLGKITA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcatacatcagccgcactgtggatcgcgttcgcgacggcgtcctccgtagac
gcctttcgcgtcacatcccgaccctcggtcacgctccgtccttggcgtaccgcactatgc
gctgaaggcaccaaaatcaccatgcccgccttgtcttccaccatgaaagaaggccgcgtc
gtgtcttggctcaagaacgaaggcgacgaaatcgaagccggcgaagccatcatggtcgtc
gagtccgacaaggccgatatggacgtcgaagcctttgaagacggagtcctcgccaaaata
ctcgtaccggaaggagccatggctccggtcggagaagccgtcgctctcatggctgaaaac
gcggccgatgtggcctccgtcatcgccagcttgggcgccggatcctccgcctccgagccg
gtcctcgatgcacccgcaccaacatccggtacgtacgtttcgcccgtcgcgtctactccc
gctacgacggcaccagcttctcccgccacggccccggccgcaccccaggcggcggctccc
cgtcccgccggagaacgcgtcacggcgtcgcccctggctcgcaagaaggcccaggaactc
ggcgttgatctcaacaccatcacgggaaccggacccagtggtcgcgttaccgcctcggac
attgaagccgccgcctcgggtaccgcgcctccccggccctccgctgtcgcccatgccgcg
gccaacggcgcgcccgccgttgaattgcccgaaggcgtcgtccccatgacgggcatgcaa
cgggcagtcagcaacaacatggtggcgaccttgccgacccccgaattccgtgtcactcgg
gaaatccaaatggacgcctttgacgcgctctaccaaaaacttaaacccaacggcatcacg
gtctccgccatgttggccaaagccgtcgccttggcgattgaaaaacatcccattatcaat
tccagcttttccgaagaaggtggtggtagtattgtttacaagaaagacatcaatattgcc
atggctgtcgccattgacggtggtctaattacaccggttttgcagtatgccaacgaacgc
agcgtcgtcgagctcggagagaattggaaagaattggtcggcaaggccaagagtggaacc
ttggcaccggccgaatacaattctggaacgtttgccatctccaacatgggcatgtttggg
gtcacgcactttggcgccattctacccaagggcattggtggtatcctcgccattggagcc
acccaagaaatgatcgttcccgatcagtcggccattctgggaatgaagaaggtcaagaaa
atgtcggtgaccctcacttgtgatcaccgccaaatttacggagccgacgctgcgctcttt
ctcaaaacactggcggatattatggaaaatcaactcggcaaaattacggcgtga

DBGET integrated database retrieval system