KEGG   Phaeodactylum tricornutum: PHATRDRAFT_24439Help
Entry
PHATRDRAFT_24439  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pti  Phaeodactylum tricornutum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PHATRDRAFT_24439
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 357 aa AA seqDB search
MSTFGNSSVASSSSSRSTSITPNDYSVPHAGNEGISSLNWSPTANILVSSNWDAGIRCWE
VQEQGGQVQANPKAQVNHEGSSPVLDTCFSADGNTVFSCGGDKAVRMWQLGSAPPNNIPQ
QIGAHDAPVQGVGFLRATNIVVSGGWDRKLKFWDCRQPTPVATLDMPERVYAMDVRDNLL
VVATAGRHIICYDVSGQPREYLRKESPLKYQTRCIACFPDQMGFAVGSIEGRVGIHYVQK
VAGRDSFAFKCHRQDSNAYSVNCIAFQKQFGTFATVGSDGIVNFWDKDNKQRLKGFNAIQ
RTISCAAFNEQGNLFAYASSYDWSQGSMHLQPGNEIFIHNVAEDEIRPKGKKASYKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgttcgggaacagtagcgtcgcctcttccagtagctcgcggtcgacgtcgatt
acgccaaacgactatagcgtccctcatgcagggaacgaaggcatcagctccctaaactgg
agtccaacagcgaatatcttggtgtctagcaattgggacgcgggtatacgatgttgggaa
gtacaggagcaagggggccaagtacaagctaacccgaaagcacaagtcaatcacgaagga
agctctcctgtgctcgacacttgtttctccgcggacggaaatactgtgttttcctgcgga
ggtgacaaagcagttcgtatgtggcagcttggatccgcacctccaaacaacatcccccaa
caaatcggggcacacgatgcacctgtccagggtgttggattcctacgtgcgacaaacatt
gttgtgtccgggggttgggatagaaaacttaagttttgggactgtcgacagcctactccg
gtcgcgactcttgatatgccggaacgcgtgtacgcaatggatgttcgagataatttgtta
gtggtggcaacggctggtcgacatattatctgctacgatgtttcaggacagccgcgggag
tatttacgcaaggagtcgccgcttaaataccaaacgcggtgtattgcgtgctttccagat
caaatgggtttcgccgttggaagtattgaaggaagagttggaattcactacgtacagaag
gtagccggccgtgacagttttgctttcaaatgtcatcgccaagacagcaacgcatattcg
gtaaattgcatcgcatttcaaaagcagttcggtacttttgcgaccgtcggtagtgacggc
attgttaacttctgggacaaggataacaagcagcgtctgaaaggcttcaatgcgatccag
cgtacaatctcatgtgccgctttcaatgagcaaggcaacttgtttgcatacgcgagcagc
tatgactggagtcaagggagtatgcacttgcaacctgggaacgagatttttattcacaat
gtagccgaagatgaaattcgtccgaagggcaagaaagcgagctataaacgataa

DBGET integrated database retrieval system