KEGG   Phaeodactylum tricornutum: PHATRDRAFT_25000Help
Entry
PHATRDRAFT_25000  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pti  Phaeodactylum tricornutum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PHATRDRAFT_25000
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PHATRDRAFT_25000
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PHATRDRAFT_25000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 221 aa AA seqDB search
MSDLTVAVSEPPAPQHMEPTDANKKQKMSYQMATDSDWPDAWHMPDAVEDQTKPNRLEPN
VPATVDELKKIGLCYWKMDAESYEYPVKAVPWNPENATDPKLKALRDDRGYSYADIITIH
PDYLPDFEKKIASFFEEHIHDAEEIRYILGGSGFFDVRNLEDKWIRIHVKKGDLMTLPEG
IYHRFTCDEERIIHAMRLFIGEPVWTPFNRPQEDHPSRKKY
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcttacagttgctgtctctgagcctcctgcaccgcaacacatggaaccgacg
gatgccaacaaaaagcaaaagatgtcctatcagatggcaacagacagcgattggcccgat
gcatggcatatgccggatgctgtcgaagaccaaaccaagcccaaccgattggagcccaat
gtcccggcaacagtggacgagctgaaaaagataggtctctgctattggaaaatggacgct
gagtcgtacgagtatcccgtcaaggctgtaccatggaatccggaaaacgccactgatccc
aagctaaaggctctccgcgacgatcgtggatatagttatgcggatatcattacgatccat
cccgattacctaccggactttgagaagaaaattgcaagcttctttgaagagcacattcat
gatgccgaggaaatccgatacattcttggtggatcaggtttttttgacgtccgcaacttg
gaagacaaatggattcggattcatgtcaaaaagggtgatctcatgacactcccagagggc
atttatcatcggttcacatgcgacgaagaacgcataattcatgctatgcgtcttttcatc
ggagagcccgtgtggacaccattcaaccgtcctcaggaagaccatccatcccgaaaaaag
tac

DBGET integrated database retrieval system