KEGG   Phaeodactylum tricornutum: PHATRDRAFT_26201Help
Entry
PHATRDRAFT_26201  CDS       T01075                                 

Gene name
PGAM_5
Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_26201 (PGAM_5)
   01230 Biosynthesis of amino acids
    PHATRDRAFT_26201 (PGAM_5)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_26201 (PGAM_5)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHATRDRAFT_26201 (PGAM_5)
Enzymes [BR:pti01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PHATRDRAFT_26201 (PGAM_5)
Exosome [BR:pti04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PHATRDRAFT_26201 (PGAM_5)
  Exosomal proteins of melanoma cells
   PHATRDRAFT_26201 (PGAM_5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 426 aa AA seqDB search
MLVPHPSGTAMRGLREEACRFLSSRSFGATVDATHARMGGNFVNSVQACNNGKRVCWHQR
NRRTFSVVATQRNGIGHRTTQGEMEAVPRRHFTSLNQSTPFQLCFLRHGQSTWNRDNIFI
GWTDTPLTDDGVLEARVAGKMLHKSGIRFDEVHTSLLRRSIRTTNLALMELGQEYLPVHK
HWRLNERCYGDLVGKNKKEVVMQHGADQVKRWRRSYDEPPPPMSDDHPYHPARDPRYQNI
LDELPKSESLKNTVERSSLYWDEVLAPALREGKTLLVVGHENNLRSLLMRLEDIAPEDII
NLSLPRAVPLAYRLDENLKPLPREDGKLDEATGFLKGTWLGGDQAVSEILDRDHKQVYDT
AITTNLEIGQDREKWNNWMEFIMGKPSAKQKRIGGDKQNGFAGGAAIPGVNHRTFTLQQE
RKQESQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttggttcctcatccttccggtacggccatgcgaggactgcgagaggaagcctgccga
ttcctctcttcgcgatccttcggcgcaacggtggatgcgacccacgcacgaatgggagga
aactttgtaaattctgtgcaagcatgcaataatgggaaacgagtttgttggcatcagcgc
aatcggcgcacattttccgttgtcgcaacgcagcgcaacgggattgggcatcggacaacc
cagggggaaatggaagccgtacccaggcggcactttacgagtctcaaccaatcaactccc
tttcaactttgctttcttcgacacggacagtcgacctggaaccgagataatatctttatt
ggatggacggacactccgttgactgatgacggggttttggaagcccgtgttgccggaaag
atgctccacaagtccggtattcgattcgacgaagtgcatacctcactgctgcgccggagt
attcgcacgaccaatctggcactgatggaactcggtcaagagtatttgcccgtacacaaa
cactggcggcttaacgaacgctgttacggcgatttagtaggcaagaacaaaaaggaggtc
gtcatgcagcacggagcggatcaagtaaaacgctggcgtcggtcgtacgacgaaccaccc
ccacccatgtcggacgaccacccctatcatcctgcgcgtgatccgcgctatcaaaatatt
ttggacgagttgcccaagtcggagtctctgaaaaataccgtggaacggtcgagcttgtac
tgggacgaagtccttgccccggctctccgcgaaggaaaaactctccttgtcgtgggtcac
gaaaacaatttgcgttcattacttatgcgtctcgaggacattgctcccgaagatatcata
aatctgagtctaccacgggctgtcccactcgcataccgcctcgacgagaatttgaagccg
ctcccccgggaagatggcaagctggacgaagcgacgggatttttgaagggtacttggctg
ggaggcgaccaggctgtatcggagatcttggatcgggaccacaaacaagtttacgatacg
gccattacgaccaatctcgaaatcggccaagatcgggagaagtggaataattggatggaa
tttatcatgggcaagccgtctgccaaacaaaagagaataggtggtgacaagcagaacggt
tttgctggcggggctgcaatacccggcgtcaatcaccgtacattcactctacagcaggaa
cggaaacaggagtcgcagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system