KEGG   Phaeodactylum tricornutum: PHATRDRAFT_26975Help
Entry
PHATRDRAFT_26975  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
pti  Phaeodactylum tricornutum
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pti03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 701 aa AA seqDB search
MATEQSREDELAAEAEELDGYFSDTPLDPQPDYPQLRESFESAVIITNLPKVGESKMDKL
TKVVMKLVSRIGTLVENPETGFTGVLMPHDKDNDTTMGFCFAEYTTKEEAKNAVEVLQGY
KFDKNHSLSVTLYARAEQLKDLDVKEFQEPQPTPFQEKPNAMSWLEDPNQRDSFVIRHGK
ETVVNWFDGRNDPILDYDGAREKEAGVQWCEFYCHWSPCGSYLATLVPDRGVILWSGENY
EKSGRFVAPGVKHIVFSPEENYILTNNDDPTDPGAIKVYHIPTGKLLRTFPLFPDGVATD
IPPPPFLWSHDDQYLARMGDGLISIFETPGMRLLDKRSLAAEGICEFQWSPKANVLVYWA
PEAENSPAHVDVIEIPSRKKLRQKNLFNVSRCNMVWQEQGDYLAVKVTRHTKSKKTLYNN
IELFRLNEPGVPVEMLDTKDAVMALSFEPRGSRFAMIHAENPSASKVNVSFYDMMKRESQ
FTYVPELNKIETLEGKQCNVIFWSPAGSNIILASLGDTASGTLEFYDVDSKSLVVKEHYR
SNQVIWDPDGRSVATVVSQPIEGGHFKFAMDNGYIIWSFQGKQLYQQSFETFYQFLWRPR
ERLLSKPEIRKVKKNLKKYEEQFDKADRERQRALYLEETKGKRSERAKIRELLARNRAIR
RKQRAEYIALLGGYDSEDDSHYVIRDLTIETVLSTKEEVVT
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgaacaaagcagagaagatgaattagcggccgaagccgaagaattggacggc
tactttagcgatacgccactcgatccgcaaccggattacccacagttacgggaatccttc
gaatcggccgtgatcatcaccaatttgcccaaagtcggagagtccaagatggataaactg
accaaagtcgtcatgaagctcgtatcccgcattggcacgctggtagaaaatccggagacg
ggcttcaccggcgttttgatgccgcacgacaaagacaacgacactaccatggggttttgc
ttcgctgagtatactaccaaggaagaagccaaaaacgcagtggaagtcttgcagggttac
aagtttgacaaaaatcattccttgtccgtcacgttgtacgctcgcgcggaacaattgaaa
gatttggacgtgaaagagttccaggaaccgcaacctactccttttcaagaaaaacccaac
gccatgtcctggctcgaagatcctaaccaacgtgactctttcgttattcgacacggcaag
gagaccgttgtcaactggtttgatggtaggaacgatcccatactcgactacgatggtgct
cgcgagaaggaagccggagtgcagtggtgcgagttttactgtcactggagtccatgcgga
tcttacctagcaacacttgtccccgaccgtggtgtcattctttggagcggggaaaactac
gaaaagtcgggacgatttgtcgctccgggcgtcaagcacattgtcttttcgccggaagaa
aattacatcttgacgaataacgatgatccaaccgatccgggggccattaaagtttaccat
attccgacgggcaagttgctacggacctttccgctcttccccgacggtgtagcaaccgat
ataccgccacctccctttctgtggagccacgacgatcaatatcttgctcgaatgggcgac
ggtctcatttccatctttgaaacgccaggcatgcgattgctcgacaaacggagtctggca
gccgaaggaatttgtgaattccagtggagtcctaaagccaacgttttggtctactgggcc
cccgaagctgagaattctccggcacacgtggatgttatcgaaattccgagccgaaagaaa
cttcgtcaaaagaatctcttcaatgtttcacgctgcaacatggtctggcaggaacagggc
gattacttagctgtcaaggttactcggcatactaagagtaagaaaactctgtacaacaat
attgagctgtttcgcttgaacgaacccggcgtgccagttgaaatgctcgataccaaagac
gccgtcatggccttatcctttgaaccgcgaggttctcgttttgccatgattcatgccgag
aatccgagtgcatccaaggtaaacgtttcgttttacgacatgatgaaacgagaaagccaa
tttacgtacgttccggaactcaacaagatcgaaactttggaggggaagcaatgcaacgtc
atcttttggagcccggctggttcgaatattattttggcgagtctcggtgatactgcatct
ggtactcttgagttctacgacgttgatagcaagtcgctagtagtgaaggaacattatcga
tccaaccaggttatttgggatcccgacggtcgaagtgttgctactgttgtgtcacagcca
atcgaaggtggacatttcaaatttgctatggataacgggtacattatctggagttttcaa
gggaagcagttgtatcaacaatcgttcgagacattttaccaatttctatggcgtcctcgc
gaacgtcttttgtccaagccagagattcgcaaagtcaagaaaaatctcaaaaagtacgaa
gaacagtttgataaggcggatcgggaacgacagcgtgctctgtacttggaagagaccaag
ggaaagcgttccgaacgcgcaaagatccgtgaacttctcgctcgaaaccgggctatccga
cgaaagcagcgtgccgagtacattgccctgttgggagggtatgactcggaggacgactct
cactatgttatccgagatcttactattgagactgtgcttagtacgaaggaggaagtcgtt
acgtag

DBGET integrated database retrieval system