KEGG   Phaeodactylum tricornutum: PHATRDRAFT_2808Help
Entry
PHATRDRAFT_2808   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PHATRDRAFT_2808
Enzymes [BR:pti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PHATRDRAFT_2808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 272 aa AA seqDB search
SGPSPVLQVTAASFEKDVLQSPGVVAVAFTAPWCGHCKRLEPVWDQAARELDGQGAVLAW
VDATAETSLAQRYQVTGYPTIKIFAKAGTKSYEDAEDHQGDRSVEGVVDFLRMKVDRAGI
PREIPEMVDMATLEKHCGGHNHICVMVALPHILESGAEGRNKYRGVLANVSKSFRSFGFL
WLEGSSQPSLESALEMTFGYPAVVALSLDRKAYAVFRGSFSEKGISGFLNSVVTGRQATV
PMTSLPTIETVTPWDGLDGAPVEEEFDLSDLF
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
agcggccctagcccagttttgcaggtgacggcagcctcgttcgaaaaggacgtcttgcag
agtcctggcgtggtagctgtggcgtttacggctccgtggtgcggacattgcaaacggcta
gagccagtttgggaccaggcagctcgtgaacttgacggacaaggcgctgtgctagcatgg
gtggacgccacggcagaaacaagccttgcgcagcgatatcaggtcaccggctatcctaca
atcaaaatatttgccaaagctggtacgaagtcgtacgaggatgcggaagatcaccaagga
gatcggtcggtagaaggcgttgtagattttctgcgaatgaaggtggatcgcgccgggatc
ccgcgcgagattccggagatggtcgatatggctaccctggaaaagcactgtggtggccac
aaccatatttgtgtcatggttgctctgccccatattcttgagagcggggcggaaggtcgc
aataagtatcgtggtgttctggccaacgtttcgaaatcctttcgctcgtttggctttttg
tggctggaagggtcatcacagccctccttggaaagcgcactagaaatgacctttggctat
cccgctgttgtggctttgagcttggatcgcaaggcctacgcagtctttcggggctcgttt
tctgaaaaaggtatcagtggcttcttgaacagcgtcgtcactggacgccaagctaccgtc
ccaatgacgtctttgccaactattgagacggttaccccatgggatggacttgacggtgct
cctgtagaggaggaatttgatttgtcggatcttttt

DBGET integrated database retrieval system