KEGG   Phaeodactylum tricornutum: PHATRDRAFT_28652Help
Entry
PHATRDRAFT_28652  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00785  Lipoic acid metabolism
pti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    PHATRDRAFT_28652
Enzymes [BR:pti01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     PHATRDRAFT_28652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-GeneID: 7202486
NCBI-ProteinID: XP_002181691
JGI: 28652
UniProt: B7G3Y9
Position
13
AA seq 314 aa AA seqDB search
MPKGRPSWFKVPAPSQGTQSTYSTASYSRYAQVKDSLQKLDLHTVCEEAQCPNIGECWNG
GTGTIMLLGDTCTRGCMFCAVNTDSKPPPPDPFEPFKTAEAVVAWGVDYIVLTSVDRDDI
ADGGAQHFAQTVQLLKQNKPNLLVECLVSDFQGMLDSVETLALSGLDVYAHNVETVERLQ
PFVRDARANYQQSLSTLQHAKVVKPELYTKTSIMLGLGETEEEVTQTMTDLRAIGVDVVT
FGQYLRPTEHHLSVVEYVTPEKFDHYRQVGENMGFKYVASGPMVRSSYKAGEFYLEHMIK
KERTEAAIDIGENA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagggaggccctcgtggttcaaagtcccggcgccttcacaaggtacgcaatct
acttatagcactgcgtcgtactcacgctacgcacaagtgaaagacagcttacaaaagcta
gacctccataccgtttgtgaagaagcgcaatgcccgaacattggcgaatgctggaacgga
ggtacgggtacgatcatgttgcttggtgacacatgtacgcgtggctgtatgttttgtgcc
gtcaacacggacagcaagccccctccaccggatccattcgaaccttttaaaacggcggaa
gccgtggtggcgtggggcgtcgactacatcgtgctgacgtcggtggaccgggatgatatt
gccgacggtggagcacagcattttgcccaaaccgtccagctcttgaaacagaacaaacca
aatttgttggttgaatgcctggtttcggattttcaaggcatgttggattcagtagagaca
ctggcactgtctggattagacgtgtacgcgcacaatgtggagacggtggaacgattgcaa
cccttcgtgcgcgacgctcgtgctaattatcaacaatccctttcgaccctgcaacacgcc
aaagtggtcaaacctgagctgtataccaaaacttcgataatgttgggcttgggtgaaacg
gaggaggaagtaacgcagacaatgacagatttgcgagccattggcgtggatgtggtgacc
tttggccaatatctgcgtccaaccgaacaccatttgtctgttgtcgagtacgtgacgccg
gaaaagtttgaccactatcgccaagtcggagaaaacatgggctttaaatatgtggcttct
ggcccaatggttcgtagctcgtacaaggcgggagagttttatctggaacacatgatcaag
aaggagcgaacggaagcagcaatagatatcggcgaaaatgcatga

DBGET integrated database retrieval system