KEGG   Phaeodactylum tricornutum: PHATRDRAFT_28797Help
Entry
PHATRDRAFT_28797  CDS       T01075                                 

Gene name
PTD9
Definition
desaturase delta 9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PHATRDRAFT_28797 (PTD9)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PHATRDRAFT_28797 (PTD9)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PHATRDRAFT_28797 (PTD9)
Lipid biosynthesis proteins [BR:pti01004]
 Desaturase
  First
   PHATRDRAFT_28797 (PTD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 333 aa AA seqDB search
MDLSSEMLREIPGTLSQHYKAGNLNYPMIVYTTIVHTVALVGLCTIPQASAETLLWAFVL
WPISGFGITVGVHRLWSHRSYEAALPVRFVLMLCNSIANQGSIYHWSRDHRVHHKFSETD
ADPHNARRGFFFAHMGWLFVKKDPAVIEAGREMDFSDLLEDPVVALQKMVDPWFALYMCY
VMPAQVASYFWGENFWTAFLVAGGLRYCFVLHCTWLVNSAAHLYGDHPYDLTSYPAENPF
VSWCAVGEGWHNWHHKYPFDYAASEFGVSSQYNPSKLVIDVLASVGLVWGRKRGTAAWAM
GRARRDRDIAQGKEMPKQPPRPWEVRTVARKIA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtcttccgaaatgctccgtgaaattcccgggacattgtcccaacactacaag
gcgggcaacctgaactatcccatgattgtttatactacgatcgtacacacagtagctctt
gttgggctctgtacgatcccacaagcttccgctgaaacgttgctctgggcctttgtcctt
tggccgatcagtggttttggtatcaccgtaggagtgcatcgactttggtcgcaccgttca
tacgaagccgcattgccagtccgttttgtccttatgctgtgcaactccattgctaatcaa
ggatccatctaccactggtcacgggatcaccgcgtgcaccacaagttctccgaaacagat
gccgacccgcacaatgcccgacgaggtttcttctttgcgcacatgggttggttgtttgtc
aagaaggaccccgccgtcattgaagccggccgggaaatggacttttccgatctcctggaa
gaccccgtggtcgccctacagaaaatggtcgatccttggttcgccttgtacatgtgctat
gtcatgccggcacaagtcgcttcctacttttggggcgagaacttttggaccgccttcctc
gttgccggtggactccggtactgtttcgtcctccactgcacctggctcgtcaactcggcc
gcacacttgtacggagatcacccctacgatcttacctcctacccggccgaaaaccctttc
gtgagctggtgtgccgtcggagaaggatggcacaactggcatcacaagtatccctttgat
tacgccgcctctgaatttggagtttcgtcccagtacaatccgtccaaactcgtcattgat
gttctggcatcggttggtttggtgtggggacgaaagcgtggtactgccgcctgggctatg
ggacgcgcgcggagagatcgggacattgcgcaaggcaaggaaatgccgaaacaacccccg
cgaccgtgggaagttcgtaccgtcgcacgcaagattgcgtaa

DBGET integrated database retrieval system