KEGG   Phaeodactylum tricornutum: PHATRDRAFT_28797Help
Entry
PHATRDRAFT_28797  CDS       T01075                                 

Gene name
PTD9
Definition
desaturase delta 9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pti01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pti01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13
AA seq 333 aa AA seqDB search
MDLSSEMLREIPGTLSQHYKAGNLNYPMIVYTTIVHTVALVGLCTIPQASAETLLWAFVL
WPISGFGITVGVHRLWSHRSYEAALPVRFVLMLCNSIANQGSIYHWSRDHRVHHKFSETD
ADPHNARRGFFFAHMGWLFVKKDPAVIEAGREMDFSDLLEDPVVALQKMVDPWFALYMCY
VMPAQVASYFWGENFWTAFLVAGGLRYCFVLHCTWLVNSAAHLYGDHPYDLTSYPAENPF
VSWCAVGEGWHNWHHKYPFDYAASEFGVSSQYNPSKLVIDVLASVGLVWGRKRGTAAWAM
GRARRDRDIAQGKEMPKQPPRPWEVRTVARKIA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtcttccgaaatgctccgtgaaattcccgggacattgtcccaacactacaag
gcgggcaacctgaactatcccatgattgtttatactacgatcgtacacacagtagctctt
gttgggctctgtacgatcccacaagcttccgctgaaacgttgctctgggcctttgtcctt
tggccgatcagtggttttggtatcaccgtaggagtgcatcgactttggtcgcaccgttca
tacgaagccgcattgccagtccgttttgtccttatgctgtgcaactccattgctaatcaa
ggatccatctaccactggtcacgggatcaccgcgtgcaccacaagttctccgaaacagat
gccgacccgcacaatgcccgacgaggtttcttctttgcgcacatgggttggttgtttgtc
aagaaggaccccgccgtcattgaagccggccgggaaatggacttttccgatctcctggaa
gaccccgtggtcgccctacagaaaatggtcgatccttggttcgccttgtacatgtgctat
gtcatgccggcacaagtcgcttcctacttttggggcgagaacttttggaccgccttcctc
gttgccggtggactccggtactgtttcgtcctccactgcacctggctcgtcaactcggcc
gcacacttgtacggagatcacccctacgatcttacctcctacccggccgaaaaccctttc
gtgagctggtgtgccgtcggagaaggatggcacaactggcatcacaagtatccctttgat
tacgccgcctctgaatttggagtttcgtcccagtacaatccgtccaaactcgtcattgat
gttctggcatcggttggtttggtgtggggacgaaagcgtggtactgccgcctgggctatg
ggacgcgcgcggagagatcgggacattgcgcaaggcaaggaaatgccgaaacaacccccg
cgaccgtgggaagttcgtaccgtcgcacgcaagattgcgtaa

DBGET integrated database retrieval system