KEGG   Phaeodactylum tricornutum: PHATRDRAFT_2936Help
Entry
PHATRDRAFT_2936   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pti00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PHATRDRAFT_2936
Enzymes [BR:pti01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PHATRDRAFT_2936
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATRDRAFT_2936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21
AA seq 344 aa AA seqDB search
GACGLSNLGNTCYANSAIQCMSYLPLLRAYLLSSQYKTAGDLNRDNPLGTGGKLLEEFAE
LLRSMWSAKLGEKSPVRFRSQLGKVNDQFSGADQQDAQEFLNYMLDVLHEDSNKPGEGLY
MQSFCVWFRGMLTLRCLSCRFLRRNRSIMADVAMGQVLNTVTCPQCNFSSRNFDPFNLLS
IPIPTAQVAGDGMDLGVCLTEFCKTQNLSLSDNWKCPRCKKFRQGQQNMNLWRLPDLLTF
HLKRFNMSARWREKLTTKINFPLTGLDLRHWCHKESPAVQVDPMESSVYDLIGVVNHYGS
MTGGHYAVSESAEPLWLQFDDELVEPLAPEHVVSEMAYVLFYRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ggtgcttgcggtctttccaacttggggaatacgtgctacgccaactctgccatacaatgt
atgagctacctcccattgcttcgggcatatcttctcagctcgcagtacaagacggccggt
gatttgaatagggacaaccctttggggaccggcggaaagcttttggaagaattcgccgaa
ttgcttcgaagtatgtggagcgcaaaacttggagaaaagtctcccgtccgctttcggtca
caacttggcaaggtcaatgaccagttttccggggcagaccagcaagatgcgcaagagttt
ttgaactacatgttggacgtacttcacgaggatagcaacaaacctggagaaggtttgtac
atgcaatcattttgtgtgtggtttagagggatgctaactcttcgttgcttgtcttgcagg
tttctccggcggaatcgctcaatcatggctgatgttgccatgggacaggttttgaatacg
gttacatgcccccaatgcaatttttcaagccgtaactttgatcctttcaacctgctttcc
attccgattcccactgcgcaagtagccggtgacggtatggatcttggagtttgtctgacc
gagttttgcaagacgcagaatctttccttgtcggacaattggaaatgccctcggtgcaaa
aagttccgccagggccagcagaatatgaatctgtggcgcctgccggatttgctcaccttt
catctcaagcgcttcaacatgtcggcgcggtggcgggaaaagctgacgacgaagataaac
tttccgttgacgggtttggatttgcgccactggtgtcacaaggaatctcccgccgtccag
gtggatccgatggagagttcggtgtacgatttgatcggtgtggtgaatcattacggcagc
atgactggtgggcattacgccgtgtcggagtcggccgaaccgctgtggttgcagtttgac
gacgaactggtggaaccgctggcaccggaacacgtagtttcggaaatggcgtacgtatta
ttttatcgtaga

DBGET integrated database retrieval system