KEGG   Phaeodactylum tricornutum: PHATRDRAFT_29658Help
Entry
PHATRDRAFT_29658  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pti  Phaeodactylum tricornutum
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pti00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 259 aa AA seqDB search
MSSKSNVGSALTGPPVCSLVPPGVCQFGPEFTAASLLGRIKVSPTSSLLRFGLPDANQPL
NLSTCACILAKITVDGEDFTRPYTPISTNADIGRFDLLIKNYGEDTKMSRYMCEVLQPGE
AVHFKHIDPNVKLQAPFPFDHILMLVGGTGLTPMVQALHAILGSINPTIDSKKPKVTMLY
GSKSSDDILGKDLLDQWAKDYPEQFKLITVLSDEPEDSDWKGERGYITKDLVADNFPSPD
ADNLQVFVCGPPPMYNALS
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaaatcgaacgtcggctctgccttaacgggcccccccgtttgctcgcttgtt
cctcccggagtctgccagtttggtccagaatttacggccgcttcattgttgggacgtatc
aaagtttctccgacttcttcgttgttacggtttggcctgcctgatgccaaccagcccttg
aatctctccacttgcgcttgcattctagccaaaattaccgtcgatggcgaagatttcacg
cgcccctacacgccgatcagcacgaacgctgacattggacgcttcgatttgctcatcaag
aactacggcgaagataccaaaatgtcgcgttacatgtgtgaggtgctccagcccggtgaa
gctgttcatttcaaacatatcgatcccaacgtgaagctccaggcgccctttcccttcgat
catatactgatgctagtgggtggaacaggattaacacccatggtgcaagcgttgcacgcc
attctcggtagcataaatccaaccatcgattccaagaaaccaaaagtcaccatgttgtac
ggaagcaagtcgagtgacgatattctcgggaaagaccttctcgatcagtgggccaaggac
tacccggagcagtttaagctcatcaccgttcttagcgatgaaccagaggactcggactgg
aaaggtgagcgcggatacattacgaaagacttggtcgccgacaactttccttcgccggat
gctgataatctccaagtcttcgtgtgcggtccgccgccaatgtacaacgccttgtcc

DBGET integrated database retrieval system