KEGG   Phaeodactylum tricornutum: PHATRDRAFT_29660Help
Entry
PHATRDRAFT_29660  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pti  Phaeodactylum tricornutum
Pathway
pti00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PHATRDRAFT_29660
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     PHATRDRAFT_29660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 7194717
NCBI-ProteinID: XP_002183169
JGI: 29660
UniProt: B7G7M6
Position
18
AA seq 260 aa AA seqDB search
MSSGSNLASALMGPPVCSLVPPGVCQFGPDFTAASLLERIKVSPTSSLLRFGLPDANQPL
NLSTCACILANADIDGEDVTRPYTPISTNADIGYFDMLIKDYGKDAKMSRYMCEVLQPGE
AVNFKHINPNVKLQAPFSFDHILMLVGGTGLTPMVQALHAILGSINPTIDSKKPKVTMLY
GSKSSDDILGKDLLDQWAKDYPEQFKLITVLSDEPEDSDWKGERGYITKDLVADNFPSPD
ADNLQVFVCGPPPMYNALSG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctggatcgaaccttgcctctgccttaatgggccccccggtttgctcccttgta
cctcccggagtctgccagtttggcccagattttacggccgcttccttgttggagcgcatc
aaagtttctccgacttcttcgttgttgcggtttggcctgcctgatgccaaccagcccttg
aatctctccacttgcgcttgcattctagcaaacgctgatatcgacggcgaagacgtgacg
cgcccctacacgccgatcagtaccaacgctgatattggttactttgatatgctcatcaag
gactacggaaaagatgccaaaatgtcgcgctacatgtgtgaggtgctccagcccggtgaa
gctgttaatttcaaacatatcaatcccaacgtgaagctccaggcgcccttttccttcgat
catatactgatgctagtgggtggaacaggattaacacccatggtgcaagcgttgcacgcc
attctcggtagcataaatccaaccatcgattccaagaaaccaaaagtcaccatgttgtac
ggaagcaagtcgagtgacgatattctcgggaaagaccttctcgatcagtgggccaaggac
tacccggagcagtttaagctcatcaccgttcttagcgatgaaccagaggactcggactgg
aaaggtgagcgcggatacattacgaaagacttggtcgccgacaactttccttcgccggat
gctgataatctccaagtcttcgtgtgcggtccgccgccaatgtacaacgccttgtccgga

DBGET integrated database retrieval system