KEGG   Phaeodactylum tricornutum: PHATRDRAFT_29736Help
Entry
PHATRDRAFT_29736  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
pti  Phaeodactylum tricornutum
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PHATRDRAFT_29736
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    PHATRDRAFT_29736
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     PHATRDRAFT_29736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
18
AA seq 247 aa AA seqDB search
MIVATDTQKNSVYVVAKQNEFHSPEEFGVLLSRFLLTQYPWLEAVDVVVDESTWQRAVVD
GQPHPHGFVKSGPEAQHAAVHMARTGETLGPPVIQSSLTCMTVLKTTQSGFEGYYLDDPY
TILPPTRERCLATELDAVWTCHGQDPTAVDYNAVRQRVRELFQKGIFGPATTGGVYSASL
QATVYDAACLILTELPDVQTISVRTPNLHYLPTTVLLGKLGETFQNDVYTPTNEPSGVIS
CTVSRGG
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcgcgacggacacgcaaaagaactctgtctacgtcgtggccaagcagaacgag
ttccacagtccagaagaattcggagtactcctcagtcgttttttgttgacgcagtatcct
tggttggaagccgtcgacgtggttgtggacgaaagtacctggcaacgtgccgttgtggat
ggtcaaccccatcctcacggatttgtcaaaagcggtccggaagcccagcatgcggccgtg
cacatggcccggaccggcgaaaccctaggaccacccgtcatccaatccagtctcacttgc
atgacggtcctcaaaaccacccaatccggtttcgaaggctactacctcgacgatccctac
accatcctcccgccgacacgggagcgttgcttggccaccgaattggatgccgtctggacc
tgtcacggtcaagatcccaccgcggttgactacaatgccgttcgccagcgtgtccgtgaa
ctattccaaaagggcatctttggtccggccaccacgggcggcgtctactccgcctcactc
caagccactgtctacgacgctgcctgtctcattctcaccgaacttcccgacgtacaaacc
atatccgtccgcacacccaacctgcactacctgcccaccacggtgctactcgggaaactc
ggagaaaccttccagaacgacgtctacacccccaccaacgaaccgagtggcgttatttcc
tgtacagtcagtcgtgggggt

DBGET integrated database retrieval system