KEGG   Phaeodactylum tricornutum: PHATRDRAFT_30461Help
Entry
PHATRDRAFT_30461  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
pti  Phaeodactylum tricornutum
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    PHATRDRAFT_30461
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     PHATRDRAFT_30461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 463 aa AA seqDB search
MTSSSSSNGASTRTMKKIGTPTKSTDLDWSGGEGVLPGRAALGPIFLMSVTPVFSIVFFH
VCANMKGNFLAFGQQCLRDGLGATITAIWPDPWDAVAWKMILSFMAFQLLLMKVIPGDRF
EATLTPKGNRPVYIANGMACYLTTLAVLVLLDLTQAFNPATIYDKFGNILSSMNVFAWCF
CLGLLVKGHVAPSSSDSGTNGSWITDFYWGMELYPRVLGWDVKMFTNCRCGMMFWAVAIV
AFCYKNMELHGGHLQYGMAVSVALQLIYIFKFFHWEMGYMCSMDIQHDRAGYYICWGCLV
WVPAVYTSQAFYLTAHAPELSTLTALAIFIAGFVCVWSNYDSDHQRYIFRQTNGDCRIWG
RQPDKIVAKYVANGVAKESLLLVDGWWKISRHFHYVPEILASFFWSVSALDTGLVGPYFY
VVFLTILLTDRAFRDDDRCRKKYGKYWTEYCEVVPYKIVPGVV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctctagctccagcaacggcgcgagtacgcggacgatgaagaagatcggaacg
ccgacgaaatcgacggacctggactggtccggcggtgagggtgtactgccaggacgcgca
gcactgggtccgatctttctcatgagtgtcactcccgtcttctccattgtcttttttcac
gtgtgcgccaacatgaagggaaatttcctcgcctttggacagcagtgtctgcgggacgga
ttgggcgccacaatcacggccatttggcccgatccgtgggacgcagtcgcgtggaaaatg
atcctttccttcatggcctttcagcttctcctcatgaaggtgattccgggagatcgtttc
gaagcgacactcacgcccaaaggcaatcgtcccgtctacatcgccaacggaatggcctgc
tacctcaccactctcgcggtactcgtgttgttggatctcacccaggcctttaaccccgcc
accatttacgacaaattcggcaacattttgtcctccatgaatgtctttgcctggtgtttt
tgcttgggactgcttgtcaagggtcacgtcgccccatcgagttccgattccggtaccaac
ggctcctggattaccgacttttactggggcatggaactctacccgcgcgtgctcggttgg
gacgtcaagatgttcaccaattgccgctgcggaatgatgttttgggccgttgcgattgtt
gccttttgctacaaaaacatggagttgcacggtggacacttgcagtacggcatggccgtt
agtgtggctctacaactcatttacattttcaagttctttcactgggaaatgggatacatg
tgctccatggacattcagcacgatcgggccggttactatatttgctggggttgtctcgtc
tgggttcccgccgtctacacctcacaggccttttacttgacggcacacgcaccggaactg
tccacactcacggccctcgctattttcatcgccggctttgtctgcgtctggagcaactac
gactccgatcaccagcgctacatcttccgacaaaccaacggggattgccgtatctgggga
cgccagccggacaaaattgtggccaaatacgtcgccaacggcgtcgcgaaagaatctctt
ctactggtggacgggtggtggaaaatctcgcgtcactttcactacgttccggaaattctg
gccagcttcttttggtccgtctcggcgttggatacaggcttggtgggaccctacttttat
gtcgtcttcttgaccattctgctcaccgatcgggcctttcgggacgatgatcgctgtcgc
aaaaagtacggcaagtactggaccgagtactgcgaagttgtgccttacaagattgtaccc
ggtgtcgtctga

DBGET integrated database retrieval system