KEGG   Phaeodactylum tricornutum: PHATRDRAFT_3062Help
Entry
PHATRDRAFT_3062   CDS       T01075                                 

Gene name
myst
Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PHATRDRAFT_3062 (myst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 349 aa AA seqDB search
YYVHYKDFNRRMDEWISKEKSNEEMLALPTDTVTTHTVGEHVVATVKAQELDEHEGLDEA
SLREHEEVTKVKNVGFMELGQYQMETWYFSPLPKELLNASGFIDVLYVCEFSFGLYARKS
ELQRFQARLPSERRHPPGNEIYRNGDLAMFEVDGMEERIYCQNLCYLAKLFLDHKTLYYD
VDPFLFYVLCEVDNRGFHPVGYYSKEKYSDVGYNLACILTFPAHQRKGYGRFLIAFSYEL
SKKEEKVGSPEKPMSDLGQQAYKPYWGSTVVDYLLNQSNESSLSIMDVSKRTSIMAEDIV
FTLNQLGILKIINGIYFIAAEKSLLQRLAEKYPVKEPRVDPSKLHWTPF
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
tactacgtgcactacaaagactttaatcgacggatggacgaatggatcagcaaagagaag
tccaatgaagagatgttggcactaccgacggatactgtgaccacgcacacagtaggggag
catgtcgtagcgacggtcaaagcccaggaacttgatgaacatgaaggcttggatgaggcg
tcgttgcgcgagcatgaagaggtaacgaaggtgaaaaatgttggtttcatggagcttggg
caatatcaaatggagacctggtatttttctcccttgccaaaagagctattgaatgcaagc
ggctttatcgacgttctgtatgtttgcgagttttcctttgggctgtatgcccgcaagagt
gagcttcaaaggttccaagcacgtcttccgagtgaaaggcgccatccacctggcaacgaa
atctatcgaaatggcgatttggcaatgtttgaagtagatggaatggaagagcgaatctac
tgtcaaaatctatgctatctcgcaaaactcttccttgatcacaagacgctttactatgat
gtggacccttttctgttttacgttctgtgtgaagtggacaatcgaggctttcatcctgtt
ggctactatagcaaagaaaagtactccgatgttggctacaatttggcttgtattttaact
tttcctgcgcatcaacgcaaagggtatggacgctttctcattgctttttcgtatgaactt
agcaaaaaggaagagaaggttggatcaccagaaaagcctatgtcagacctcgggcagcaa
gcctataagccctactggggttcaacggtggttgattatttgttgaatcagtccaatgaa
tcttcgttgagcattatggacgtttcgaaaaggacatcaatcatggccgaagacattgtt
tttacgttgaatcaactagggattttgaagatcatcaacggtatatactttatcgcagcc
gaaaagagcctgcttcagcgattggcagaaaaataccccgtaaaggaacctcgagtggat
ccatccaagcttcattggactcccttt

DBGET integrated database retrieval system