KEGG   Phaeodactylum tricornutum: PHATRDRAFT_30786Help
Entry
PHATRDRAFT_30786  CDS       T01075                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pti  Phaeodactylum tricornutum
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pti00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pti00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
26
AA seq 445 aa AA seqDB search
MPEFFADNVPETIPYKGPTSKDPFSFRHYNPDESILGKPMKEWLRFSVCFWHTLVGGGGQ
DPFGAKTLRRPWEDGIDDALELAKRSIDVAFEIFTILGVEYYTFHDFDVAPEMATLKESQ
KALEDVGDYLLKKQNESGVRLLWATQNLFAHPRYMHGALTNPDVHVFCYAAAQIQNIMDL
NAKLGGANHVFWGGREGYQTLLNTDVKQECDHAAAMFRMAIDYKARKNYTAQFLLEPKPR
EPTKHQYDYDAQTTMAFLHEYGLQDQFLLNIEPNHTTLAGHAPEHDVVVASAYNMLGSID
SNTGDTLVGWDTDQFPMNLQDTTAIMSVVLKQGGFQKGGLNFDCKVRRESVDPEDIILGH
VAAMDCYALGLRKAAAMQQAGELDSMLQARYASWQTGSLGRKISNGQATLEECAEYAKEK
GEPVLQSGKQEMFEMVRNRYLYPGN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttctttgccgacaacgttccggagactattccgtacaagggtccaacgtcg
aaagatcctttttcctttcgtcactacaaccctgacgagagtatccttggcaagcccatg
aaggaatggttgcgtttcagtgtatgcttttggcatacgctcgtgggtggcggcgggcag
gatcctttcggagcaaaaactttgcgacgaccttgggaagacggcatcgacgatgccctg
gagctggccaaaaggagcatcgacgtggcgttcgagatctttaccattcttggagtcgag
tactacacctttcacgatttcgacgtggcgccggaaatggccacgctcaaggaatcgcaa
aaagcactcgaggatgttggcgactacctactgaaaaaacaaaacgagtcgggtgtccgg
cttttgtgggcgacacagaatctctttgctcatccgcgttatatgcatggtgccctgacg
aatccggatgtacacgtcttctgctacgccgcggcgcaaattcagaatattatggacttg
aacgccaaactcggcggggccaaccacgtcttttggggcggccgcgaaggctaccaaacc
ctcttgaatacggacgtcaaacaagagtgcgatcacgcagccgccatgtttcgcatggcc
attgattacaaagcccgcaaaaactacacggcccagttcttgctcgaacccaaaccgcgg
gagcccaccaagcatcagtacgattacgacgcccaaacaactatggcgttcttgcacgaa
tacgggttacaggatcaatttctgctgaatattgaaccgaatcacacgacattggcagga
cacgctcccgaacacgacgtggtcgtggccagtgcctacaacatgctcggtagcattgat
tccaataccggtgataccctggtcggctgggataccgaccaatttccaatgaatttgcaa
gacacgacggccattatgagtgtcgtcctgaaacagggaggtttccaaaaggggggattg
aattttgattgcaaggtgcgacgtgaaagtgtggatccggaagatatcattctcggtcac
gtggcggccatggattgctacgctctaggtctacgcaaggctgccgcaatgcagcaagcc
ggcgagcttgatagtatgctccaggctcgctacgcttcctggcaaacgggaagtctgggt
agaaaaataagcaatggtcaggccaccttggaagaatgcgccgagtacgccaaagagaag
ggagagccggttttacagtccgggaaacaggaaatgtttgaaatggttcgcaatcgttat
ctatatcccggcaattag

DBGET integrated database retrieval system