KEGG   Phaeodactylum tricornutum: PHATRDRAFT_31109Help
Entry
PHATRDRAFT_31109  CDS       T01075                                 

Gene name
PPO
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHATRDRAFT_31109 (PPO)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PHATRDRAFT_31109 (PPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
29
AA seq 520 aa AA seqDB search
MIAQCFLVTLSLVQSAAAFVAPRAASPFTASSHFHSPIPQLYAAAREVDCLVVGSGVSGS
SLAFNLVKNHDVDTLMVERNEVVGGNLISKENEEGFVWEEGPNSFQPTPYISRLVHELGI
TKDLVLADGSLPRFVYWQGEGAGAKLANLHALPTNLPGDLLDFNLLTWPGKIRAGLGAIG
LIAPPPTDREESIREFVTRHLGAETFERVIDPFVSGVYAGDPDELAMKAALKKIHRLEGL
GDLGPGLVSGAINRFKEIADEKTSNPPDPAWPTYKGGQLGSFRKGLQTLALAAEEYLGPE
RVMKNTPIDKVEKLPDGRFKVTVLKDDKPIEIIAKSVCLTSPTRVTCKVAADLVPAATRL
AEVYSPPVASVTMAYKKEWFKELPGGTSREPLRGFGHLLPRKMGVRSLGTIWSSSLFPGR
APEGWELLLTYIGGARDKGIADLSEEEIYKQVDADNHEILLKSDAPSGKRIGIRVWQTAI
PQYRKGHLEILDALEADEAKVPGFYLGGNYRTGFFFCCLW
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacaatgctttctagtaactcttagtttggtgcagtcggcggctgcatttgtg
gcccctcgcgcggcgtcgcccttcacggcatcgtcacattttcactccccgataccacaa
ctatacgcagcggctcgagaagttgattgcttggttgtggggtcgggcgtatctggaagc
tctctcgcctttaatcttgtaaagaaccacgatgttgacacccttatggtcgagcggaac
gaagttgtcgggggcaatctcatttcgaaagaaaacgaggaagggtttgtctgggaagaa
ggtcccaattctttccagcctactccctacattagtcgactcgttcacgaattgggcata
acgaaggacctcgttctcgcggatgggtctttgcctcgttttgtgtattggcaaggcgaa
ggtgcgggcgcaaagctggcgaacttacacgctttaccaacaaatttacccggggacttg
cttgacttcaacctgttgacctggcccggaaagattcgagctgggctcggtgcgattggc
cttatcgctccaccaccgacggatcgtgaagagtctataagggaattcgttacccgtcat
ttgggtgccgaaacatttgaacgcgtgatcgatccgttcgtgtccggtgtatatgctgga
gatcctgacgaactggccatgaaggccgctctaaaaaaaattcatcgactggaagggcta
ggagatcttgggccgggtctggtcagtggtgcgatcaatcgattcaaggaaattgccgac
gaaaagacgtcgaacccacccgatccggcctggcccacttacaaaggaggccagctgggt
tctttccgtaaaggtttgcaaacacttgccctagcggcggaagaatacctaggaccggag
cgtgtaatgaagaacacgcctatagacaaagttgaaaaactgcccgacggtcggtttaaa
gtaacggtcctgaaggatgataaaccgatcgaaataattgctaaatccgtctgtctgacc
tcgccaacccgtgtcacgtgcaaggttgccgctgacttggttccggctgccactcggctg
gctgaagtatactcacctcccgttgcatctgtcaccatggcctacaagaaagagtggttt
aaggagttgcccggtggtacctcgagggaacctttgcgtggattcggccacttgcttccg
cgtaaaatgggagtccggagtttgggtaccatctggtcgagttctctgtttcctggtcgc
gctcctgaaggctgggagctcttgctaacctacattggtggtgcacgggacaaaggcatt
gcggacttgtccgaagaagaaatttacaaacaagtcgacgcggataatcacgagattctg
ttgaaaagtgacgctccgtctggcaaaaggattggcattcgagtgtggcaaactgccata
ccgcagtaccgtaagggtcatttagaaattttggatgcattggaagccgacgaggccaag
gtgcccgggttttatttgggaggtaattaccggaccggtttttttttttgttgcctttgg
tga

DBGET integrated database retrieval system