KEGG   Phaeodactylum tricornutum: PHATRDRAFT_31948Help
Entry
PHATRDRAFT_31948  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pti  Phaeodactylum tricornutum
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pti00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 317 aa AA seqDB search
MQQINEDACVRGCHEIRDVQEERDQGSSFHVEFKDSSDPRSALTEADSRAQKAIVAALKQ
DWGPELRIIGEEDPKDGFLSVATNKTALRINLCSSIFKEDCDMQTLSDIIVFVDPLDGTR
EFVEGRLQNCQVLIGISVGGIASAGAIGIPFPTGNLDESPTVVYGKVGLGHGIIGSPLPN
AHGRIPLSQPLLATGDTILPIMAEARRIVQEHFGGINCLYGGAGNKILAAALGLVDCTIQ
HKFGGPWDTCAPAAVLKSMGGEITDLLGEDLSVYQEGEQEQSTRRGFVATGRNSLIPHKV
LVAALQESKRITTYING
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaatcaatgaagatgcgtgtgtacgagggtgccatgagatccgcgacgtccaa
gaagaaagggaccaagggtcgtccttccatgtggaattcaaagattcatctgatccaagg
tcagcgcttacggaggctgacagtagagctcaaaaagctattgtcgctgctttgaaacaa
gattgggggcccgaactaagaatcatcggagaagaggacccaaaggatggatttctttcg
gttgcaacaaacaaaacagcactacggatcaatctgtgctcatccatttttaaggaagac
tgtgacatgcaaactctttcggacatcattgtatttgtggaccctctggatggaacaagg
gaattcgtcgaaggacggcttcaaaactgtcaggttctgattggtatttctgtcggcgga
attgcgtcagcaggggcaatcggaattccttttccaacaggaaatttagacgaatcgccc
acagttgtatatgggaaagtcggactcgggcacgggattattggaagcccacttcccaat
gctcatggtcggattccgctatcacaacccttactggcgacaggggatacaattcttcca
attatggctgaggcaagacgtatagtgcaagagcattttggaggtataaactgcctctac
ggaggtgcagggaacaagatcctcgctgctgctcttggacttgtggattgcacaatacaa
cacaaatttggtggcccgtgggacacatgcgcccccgcagcagtgctaaaatcaatgggt
ggtgaaatcactgacctgctaggagaggatctttctgtctatcaagaaggagagcaagaa
cagtcaaccaggagaggatttgtagccacagggagaaactccctcatcccacacaaagtt
cttgttgcggccctgcaggaatctaaaagaatcaccacatatataaacggctag

DBGET integrated database retrieval system