KEGG   Phaeodactylum tricornutum: PHATRDRAFT_32940Help
Entry
PHATRDRAFT_32940  CDS       T01075                                 

Gene name
RPA2
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
pti  Phaeodactylum tricornutum
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:pti00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PHATRDRAFT_32940 (RPA2)
   03420 Nucleotide excision repair
    PHATRDRAFT_32940 (RPA2)
   03430 Mismatch repair
    PHATRDRAFT_32940 (RPA2)
   03440 Homologous recombination
    PHATRDRAFT_32940 (RPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2
AA seq 270 aa AA seqDB search
MDYQGGGGFGNSGSAGGSGYSGGGGSAGNSGGKARRSYDEQTMVPVTIRMCLGAMPDEIS
EGVGGLQLEDGRRLYHVRFVAAVRSFEDFSTNVVYTLEDGTGLMEVKQWLDDNHCTAIAE
MRQHTLKENIYLKVVGQIKEYDGKKMVVAESIRVLSTGNELAHHMLEVVYAGETFKRKDS
IVAPQSSMMFNTNTVKGSALHANSSDGGWKDELLRFIRMEGDKSDMGVSIDACIKYIGRP
SSEVHQAVADFSSNGNLYSTIDENYYKFAM
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggactatcaaggtgggggaggttttggaaacagcggaagtgccgggggtagcggctac
agtggcggtggcggtagtgcggggaatagtggaggcaaagctcgtcggtcctacgacgaa
caaaccatggtccccgtgacgattcgaatgtgtctgggagccatgccggacgaaatatcc
gaaggcgtgggaggcttacagctcgaagatgggcgtagactctaccacgtgcgtttcgtc
gcagctgtccgctcgttcgaggacttctcgacgaacgtcgtctacaccttggaagacggc
accggattgatggaagtcaagcaatggctggacgataaccattgtaccgcaattgccgag
atgcgtcagcacacactcaaggaaaatatctatctgaaagttgtggggcagattaaggaa
tacgacggtaaaaaaatggtcgtagccgaatcaatccgggtactatcgactgggaacgaa
ctggcccaccacatgctcgaagtagtctacgctggggaaactttcaagcgcaaggacagt
atcgttgcaccgcagtcatctatgatgttcaacaccaataccgtgaaaggatcggcgctg
catgccaactctagtgacggcggatggaaggacgagctgctgcgctttatccggatggaa
ggggacaagtccgatatgggggtcagtatagatgcctgtatcaagtacattggacgccca
tcgtccgaagttcatcaggccgtagctgatttctcttccaatggaaatctgtactcaact
atcgacgagaactactacaagtttgctatgtaa

DBGET integrated database retrieval system