KEGG   Phaeodactylum tricornutum: PHATRDRAFT_34488Help
Entry
PHATRDRAFT_34488  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     PHATRDRAFT_34488
Protein kinases [BR:pti01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   PHATRDRAFT_34488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 745 aa AA seqDB search
MKEKRVGKPRVIELLQKAAAKAAAEGDPWAKYNLPAIPAERIIRHLYHPETQTWTTDESV
VKIERTPFTHGAMRHCYRMKKRATPPESATNHRFHKHGWSRALNYIAKAYHKDDEIDTSD
EAKRAVQNDVMLQYEAQHWAKKFNENGPPSKILFIRAYVVEFPDREAQPWFAVERYIAGN
DWYGLGFVKHNTNAGFVDTELHRVTPQVFSAYSFYASEGTRLVADIQGVGDLYTDPQVLS
SDYRFGDGDLGPRGMALFFKTFRHNAISDAAGIPIFPLSKNELRVQAKYEEDEITVSDDE
QSLESNGIPLDRFQLLDLNRMRRSRALKSPRDLLQFEEKDTFKRSNISRDAISDSLRSSM
RMSVPPNAHLLRSKSEVTETQSCLDRARKDLAFTHHDFHRHISGELRERQYKRQLKECEF
RKTTIVRKVSAPIIPTDRTVENLGKVHYQLAMLHGMGRFPETIPEIVGKSIEGRPEHDAF
SVLFHLSYAASLQNSPACLALARVHAGLGTIVSGLLNSIVPIDFEAAKDLLRRAMTSSQL
PNAPKAAAGCLLYQLLHDERKVRGEEIPSDNILIRTLKDTIVLIETAEDEQNKVSQHKKR
AKKTIVRIHEGDRVEANYCLEGTFYPGDVLHVSDDGQNIAVRYDDDGSEETLAKEQVRLL
IPPTTTQTSLGGPLSDEEAFGSEQGDDKFLLQKYELQAELAALYETTGEVAAACRLYELA
ADAAVQNGKMQNATQWSLKAGELEP
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagaaacgggttgggaagccgagagtcatagaattgcttcaaaaggcggccgcg
aaggccgccgccgaaggagatccgtgggccaaatacaatctcccggcaatccccgccgaa
cgcataatccgacacttatatcaccctgagacgcaaacgtggacaacggacgagtcggtt
gtaaagattgagcggacgccttttactcacggtgctatgcggcattgctatcgcatgaag
aaacgagcgacaccccccgagtctgctaccaatcatcgcttccacaagcatggatggagt
cgcgctttgaactacatcgccaaagcctatcacaaggatgacgaaattgacacttctgat
gaagctaagagagccgtacaaaacgatgttatgctccagtacgaagcacaacactgggct
aagaaatttaacgaaaatggcccaccttcaaaaatcctattcatccgagcttacgtcgta
gaatttcctgacagggaagcgcagccttggtttgcggtagagaggtatattgcaggaaat
gattggtacggacttggctttgtgaaacacaataccaatgctggattcgtggatacagaa
ctgcaccgagtgacaccacaagtctttagtgcatattctttctacgccagcgaaggtaca
agactcgtggcggacattcaaggggttggcgacttgtacacagacccgcaagttctgtct
tctgattatcgctttggcgatggagatttgggccctagaggaatggcattattttttaag
acatttcggcataatgcaatctcagatgctgctggaattccaatttttcctctttcgaag
aatgaattgcgagtgcaggcgaagtatgaggaggacgaaatcacagtctcggacgatgag
cagtctttagaatcaaacgggatccctctagatcgatttcaactgcttgatttgaatcgt
atgcgacgatcgcgcgcactgaagtctccgagagatctccttcagtttgaagaaaaagac
acttttaaaagatccaacatttctcgtgatgcaatcagtgattcgctgagatcttccatg
cgcatgtctgtgcctccaaatgcccatctgctacgatctaaatcggaagtaactgagacg
caaagttgtttagatcgggctcgtaaagacttggcttttacgcaccacgatttccatcgt
cacatctctggagagcttcgtgaacgccaatacaagcggcaattgaaggagtgtgagttt
cgcaagacaacgatcgtacgaaaagtgtcagctcctataattcctaccgatcgtacagtg
gaaaatcttggcaaagtccattatcaacttgcaatgctgcatggaatgggtcgctttcct
gagacgataccagaaatagttggcaaatcaatagagggacgacccgagcatgacgctttt
tctgttctgtttcacctctcgtatgcggcgtcgttgcagaattcacccgcttgtctagcc
ttggcaagggtccacgctggattaggtacgattgtctctggcttactcaacagcattgtt
ccaatcgattttgaagcagccaaagacctgctacgtcgagccatgacttcatcacagcta
cctaatgcacccaaggcagcagctggttgtctcttgtaccaacttctccacgatgagcga
aaagtgcgtggagaagagataccatcggacaatatcttaatacgtactctcaaagacacc
attgttctgattgaaacggccgaggacgagcaaaacaaagtatcacagcacaaaaagcgg
gcgaaaaaaaccatagttcgcatccacgaaggcgatcgagtagaagccaattattgtctg
gaaggaactttttaccctggagatgtcttgcacgtatcggatgacggtcagaatattgcc
gttcggtacgacgacgatggttcggaagaaacgctggcgaaggaacaagtccggcttttg
attccccccaccacgacacaaactagtcttggtggaccgctgtctgacgaggaagccttc
ggatcggaacagggtgacgataaatttttgctacaaaagtacgaactgcaggccgagcta
gcggcactctacgagactaccggagaggtggcggccgcctgtagactttacgaactggca
gcggatgctgctgttcaaaatggcaaaatgcagaatgctactcagtggagcttgaaagct
ggcgagctagaaccttag

  All links  
No link information was found.   
DBGET integrated database retrieval system