KEGG   Phaeodactylum tricornutum: PHATRDRAFT_35240Help
Entry
PHATRDRAFT_35240  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:pti01200]
Metabolism; Overview; Fatty acid metabolism [PATH:pti01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pti00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pti00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:pti00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:pti00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pti01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:pti00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pti00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pti00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:pti00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 684 aa AA seqDB search
MAEEAKKLWKDEIASNSDVKAVVFSSAKPDMFIAGADIFDIKAVENKQDLIPFIADGVKF
FQDMRGKGVPLVAAIDGPALGGGLEWALWCDYRICTDSSKTKMGLPEVKLGLLPGFGGTQ
NLHPVVGLQNAMDMMLTGKDIRPHQAKKMGLVDLVVAQASLERVAIDSAAALANGSLKAK
RKSKSMFNKILEDNSIGRNVIWNQIDKMVQKNTNGKYPAPYAIIDCVKFGLDNPSQKYQH
EREEFAKLAATPESEALIGIFDGMTQMKKHSFGADAAIPVKTVAVMGAGLMGAGIAQVTA
EKGIKVLLKDRNDEAVGRGQSYMTENWSKKLKRKRMTQYQYNLNTSNVTALTDDSPTWQR
HFGNADMVIEAVFEDLDLKRKIVANVESVTKDHCIFATNTSAIPIADIAQGASRPENIIG
MHYFSPVPSMPLLEIIPHTGTSDTATATAFEIGSKQGKTCIVVKDVPGFYVNRCLGPYLV
EVSALVRDGVPLEALDKSLKNFGMPVGPITLADEVGIDVSSHVAKFLSNADLGVRMEGGD
VSLMEQMIGKGWLGKKSGQGFYTYKGKKKTINEEVQKYVKDFATRDLKLDEKEIQDRIVS
RFVNEAAKCLEDEIIENPVVGDIGLVFGTGFAPFRGGPFRYLDQVGVASYVDRMNTFTDK
YGPQFEPCQLLKDYAATDKKFHKR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaagccaagaaactctggaaggacgaaattgcgtccaacagcgacgtgaaa
gccgtcgtattctcgtccgcgaaacccgacatgttcattgccggcgccgatatctttgac
attaaagccgtcgagaataagcaggacctgattccctttatcgccgacggtgtgaaattc
tttcaagacatgcgaggcaagggtgtccctctcgtggccgccatcgacggacccgccctc
ggtggtggtctggaatgggcgctctggtgcgactaccgtatttgcacggacagttccaag
accaaaatgggacttcccgaagtaaagctcgggcttttgcccggtttcggcggcacgcag
aacttgcatcccgtcgtgggcttgcaaaacgccatggatatgatgttgacggggaaggat
atacgtccgcaccaggccaaaaaaatgggcttggtggacctggttgtggcgcaggcctcc
ttggaacgtgtcgcgattgattcggcggctgctctggccaacggatcgctcaaagccaag
cgcaaatccaaatctatgtttaacaagatcctcgaagacaactcgatcgggcgcaacgtc
atttggaaccaaattgacaaaatggtgcaaaagaacaccaacggcaagtacccggcaccc
tacgccattatcgattgcgtcaaattcggtttagacaatccctcacaaaagtaccagcat
gaacgtgaggaattcgctaaactcgccgcgacgccggaatcggaagcacttattggtatt
ttcgacggcatgacgcagatgaaaaagcactcgttcggtgctgatgccgccattccggtc
aagaccgtggctgtcatgggtgcggggttgatgggagccgggattgcccaagtaacggca
gaaaaggggatcaaagtcctactcaaagaccgcaacgacgaagcagtcggtcggggtcaa
tcctacatgacggagaattggagcaaaaagctcaaacgcaagcgcatgacacagtatcag
tacaacctgaatacttccaacgtcactgcactcaccgatgatagtccgacttggcaacgt
catttcggaaatgctgacatggtgattgaagccgtgttcgaagatttggatctcaaacgc
aagattgtcgccaacgtcgaatccgtcaccaaggatcactgtatttttgccaccaataca
tccgccattcctatcgccgatattgcgcagggcgcttcgcgtccggaaaacatcatcggt
atgcactacttctcaccggtaccatccatgcccttactcgagattattccacataccggt
acgagtgataccgctacggcgaccgctttcgaaattggttcaaagcaaggcaaaacctgc
attgtggtcaaggatgtccccggcttttacgtgaatcgctgtttgggtccgtatttggtc
gaagtgtcggcgctcgttcgggacggtgtaccgctcgaggcactcgataagtcgctcaag
aatttcggcatgccggtgggccccataacactagccgacgaagtcggtattgacgtgagt
tcgcacgtggccaagttcttgtccaatgccgacctgggagtacgcatggagggtggtgac
gtctctctgatggagcaaatgattggcaaaggatggctgggcaaaaagtctggtcaaggg
ttctacacctacaaaggcaagaaaaagaccatcaacgaggaagtacaaaagtacgtcaag
gactttgccacacgcgacttgaaattagacgagaaggaaatccaagatcgcatcgtgagt
cgctttgtgaacgaagcggccaaatgcttggaagacgagatcattgaaaatcctgtcgtt
ggtgacattggtctggtgttcggtacaggctttgcccccttccggggtggtccgttccgg
tacctagatcaggtcggcgtcgcatcgtacgtagatcgcatgaacacgttcaccgacaag
tacggtccgcaattcgaaccgtgtcaactactgaaggattatgccgcaacggacaaaaag
tttcacaaacggtag

DBGET integrated database retrieval system