KEGG   Phaeodactylum tricornutum: PHATRDRAFT_35240Help
Entry
PHATRDRAFT_35240  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
pti  Phaeodactylum tricornutum
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_35240
   01212 Fatty acid metabolism
    PHATRDRAFT_35240
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PHATRDRAFT_35240
   00650 Butanoate metabolism
    PHATRDRAFT_35240
  Lipid metabolism
   00062 Fatty acid elongation
    PHATRDRAFT_35240
   00071 Fatty acid degradation
    PHATRDRAFT_35240
   01040 Biosynthesis of unsaturated fatty acids
    PHATRDRAFT_35240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PHATRDRAFT_35240
   00310 Lysine degradation
    PHATRDRAFT_35240
   00380 Tryptophan metabolism
    PHATRDRAFT_35240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PHATRDRAFT_35240
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     PHATRDRAFT_35240
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PHATRDRAFT_35240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 684 aa AA seqDB search
MAEEAKKLWKDEIASNSDVKAVVFSSAKPDMFIAGADIFDIKAVENKQDLIPFIADGVKF
FQDMRGKGVPLVAAIDGPALGGGLEWALWCDYRICTDSSKTKMGLPEVKLGLLPGFGGTQ
NLHPVVGLQNAMDMMLTGKDIRPHQAKKMGLVDLVVAQASLERVAIDSAAALANGSLKAK
RKSKSMFNKILEDNSIGRNVIWNQIDKMVQKNTNGKYPAPYAIIDCVKFGLDNPSQKYQH
EREEFAKLAATPESEALIGIFDGMTQMKKHSFGADAAIPVKTVAVMGAGLMGAGIAQVTA
EKGIKVLLKDRNDEAVGRGQSYMTENWSKKLKRKRMTQYQYNLNTSNVTALTDDSPTWQR
HFGNADMVIEAVFEDLDLKRKIVANVESVTKDHCIFATNTSAIPIADIAQGASRPENIIG
MHYFSPVPSMPLLEIIPHTGTSDTATATAFEIGSKQGKTCIVVKDVPGFYVNRCLGPYLV
EVSALVRDGVPLEALDKSLKNFGMPVGPITLADEVGIDVSSHVAKFLSNADLGVRMEGGD
VSLMEQMIGKGWLGKKSGQGFYTYKGKKKTINEEVQKYVKDFATRDLKLDEKEIQDRIVS
RFVNEAAKCLEDEIIENPVVGDIGLVFGTGFAPFRGGPFRYLDQVGVASYVDRMNTFTDK
YGPQFEPCQLLKDYAATDKKFHKR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaagccaagaaactctggaaggacgaaattgcgtccaacagcgacgtgaaa
gccgtcgtattctcgtccgcgaaacccgacatgttcattgccggcgccgatatctttgac
attaaagccgtcgagaataagcaggacctgattccctttatcgccgacggtgtgaaattc
tttcaagacatgcgaggcaagggtgtccctctcgtggccgccatcgacggacccgccctc
ggtggtggtctggaatgggcgctctggtgcgactaccgtatttgcacggacagttccaag
accaaaatgggacttcccgaagtaaagctcgggcttttgcccggtttcggcggcacgcag
aacttgcatcccgtcgtgggcttgcaaaacgccatggatatgatgttgacggggaaggat
atacgtccgcaccaggccaaaaaaatgggcttggtggacctggttgtggcgcaggcctcc
ttggaacgtgtcgcgattgattcggcggctgctctggccaacggatcgctcaaagccaag
cgcaaatccaaatctatgtttaacaagatcctcgaagacaactcgatcgggcgcaacgtc
atttggaaccaaattgacaaaatggtgcaaaagaacaccaacggcaagtacccggcaccc
tacgccattatcgattgcgtcaaattcggtttagacaatccctcacaaaagtaccagcat
gaacgtgaggaattcgctaaactcgccgcgacgccggaatcggaagcacttattggtatt
ttcgacggcatgacgcagatgaaaaagcactcgttcggtgctgatgccgccattccggtc
aagaccgtggctgtcatgggtgcggggttgatgggagccgggattgcccaagtaacggca
gaaaaggggatcaaagtcctactcaaagaccgcaacgacgaagcagtcggtcggggtcaa
tcctacatgacggagaattggagcaaaaagctcaaacgcaagcgcatgacacagtatcag
tacaacctgaatacttccaacgtcactgcactcaccgatgatagtccgacttggcaacgt
catttcggaaatgctgacatggtgattgaagccgtgttcgaagatttggatctcaaacgc
aagattgtcgccaacgtcgaatccgtcaccaaggatcactgtatttttgccaccaataca
tccgccattcctatcgccgatattgcgcagggcgcttcgcgtccggaaaacatcatcggt
atgcactacttctcaccggtaccatccatgcccttactcgagattattccacataccggt
acgagtgataccgctacggcgaccgctttcgaaattggttcaaagcaaggcaaaacctgc
attgtggtcaaggatgtccccggcttttacgtgaatcgctgtttgggtccgtatttggtc
gaagtgtcggcgctcgttcgggacggtgtaccgctcgaggcactcgataagtcgctcaag
aatttcggcatgccggtgggccccataacactagccgacgaagtcggtattgacgtgagt
tcgcacgtggccaagttcttgtccaatgccgacctgggagtacgcatggagggtggtgac
gtctctctgatggagcaaatgattggcaaaggatggctgggcaaaaagtctggtcaaggg
ttctacacctacaaaggcaagaaaaagaccatcaacgaggaagtacaaaagtacgtcaag
gactttgccacacgcgacttgaaattagacgagaaggaaatccaagatcgcatcgtgagt
cgctttgtgaacgaagcggccaaatgcttggaagacgagatcattgaaaatcctgtcgtt
ggtgacattggtctggtgttcggtacaggctttgcccccttccggggtggtccgttccgg
tacctagatcaggtcggcgtcgcatcgtacgtagatcgcatgaacacgttcaccgacaag
tacggtccgcaattcgaaccgtgtcaactactgaaggattatgccgcaacggacaaaaag
tttcacaaacggtag

DBGET integrated database retrieval system