KEGG   Phaeodactylum tricornutum: PHATRDRAFT_35463Help
Entry
PHATRDRAFT_35463  CDS       T01075                                 

Gene name
Aurora-A
Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 327 aa AA seqDB search
MSTMDKENAELNSPVKGSWKRGLSPKAAFEASLAAEATITLASSSTNSRHSEAEKGQRWS
LKDFEIGKPLGRGKFGSVYLAREKRTKYIVAIKVLQKSQLLKAGVEHQLRREIEIQSHLR
HANILRMYGYFYDNKRIYLILEYSPGGELYKKLTTRGRFSEGTTAQYISDLALALNYCHS
KHVIHRDIKPENLLLGAYGEIKIADFGWSVHAPTSRRNTLCGTLDYLPPEMVEGREHDEN
VDVWCLGVLLYEFLTGAPPFEAEGHSATYRRISRVDLVFPRGVAEDAQDLIRKLLVKEPN
KRMCLRNVPKHPWILRNTASTNSNGNS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccatggataaagagaatgcggaattaaattccccggtcaaaggtagctggaaa
cgtggattgagtccaaaagctgcttttgaggcctcgcttgccgcagaagcaacgataaca
ctagcgagcagctcgaccaacagccggcacagcgaggccgagaaagggcaacgttggtct
ttgaaggactttgaaatagggaaacccctcggtcggggtaagtttggatccgtgtatctc
gcacgggagaaacgcaccaagtacattgtggccataaaagtcctccaaaaatctcaattg
ctcaaggctggtgtcgagcatcaactacgccgtgaaatcgagattcaaagccacctgcgc
catgccaatattctacgaatgtatggatatttctatgacaacaagcgcatctacttaatt
ctggaatactcacctggcggagagctgtacaaaaagctaactacccgtggacgattttcg
gaaggaacgaccgctcagtacatctcggacttggccctcgcgttgaattactgtcatagc
aagcatgtcatccatcgagacatcaaaccagaaaaccttcttcttggtgcctatggcgaa
atcaaaattgccgattttggttggtctgtgcatgcgccgacgtctcgacgaaacaccttg
tgcgggacactcgattatcttcctccggagatggtagaaggacgagaacacgatgagaat
gtggatgtctggtgcctaggggtgctcctatacgaattcttgactggtgccccgcctttt
gaagccgaaggacattcagcgacatacagacggatttcaagggttgacttagtttttcct
cgtggtgttgcggaggatgcccaagaccttatccgtaagctgttggtaaaagagccgaac
aaaagaatgtgtttacgaaatgtcccgaagcatccgtggatcttacgaaatactgcttcg
accaacagcaatggaaatagctga

DBGET integrated database retrieval system