KEGG   Phaeodactylum tricornutum: PHATRDRAFT_38509Help
Entry
PHATRDRAFT_38509  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHATRDRAFT_38509
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PHATRDRAFT_38509
Enzymes [BR:pti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PHATRDRAFT_38509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16
AA seq 301 aa AA seqDB search
MTYGQPFVGTDSGPELLRQAGLRKMLSALGWRVEDVPDLEFEALQLSEKSGTFEGNAKNH
KLVGAGCEMLANAVEKTLKQKRFPLILGGDHSIGMGSLAGILRAQPETGVIWIDAHADLN
TPALSESGNMHGMPVGMLMEGVAPDHRQIPGLEWLADGPRLSPDSIVYVGLRDVDPAERR
LIQSLDIAAYTMHEIDRYGIGQVMEMALDHLCAKNPNRPLHLSYDIDAVDPVLAPATGTT
VRGGLTFREAHYVAEAVAYTGNLASAEIVELNPSLSCGEGAEATVELGLQLITSFMGKSI
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacctacggacagcccttcgtgggcaccgacagtggaccggagcttttgcgtcaagcg
ggattgcgcaagatgttgtccgccttgggatggagagtagaagatgtaccggacttggaa
tttgaagctttgcagctttcggaaaaaagcggaaccttcgagggaaatgcaaaaaaccac
aagctcgtcggtgctggctgtgaaatgctcgccaacgccgtggaaaagacattgaagcaa
aagcgctttcctcttattttaggcggcgaccattctataggtatgggtagtctggccggt
attttgcgtgctcaaccggaaactggggtgatttggattgatgcgcacgctgatttaaac
accccagcgttgagtgaatccggaaacatgcacggcatgcccgtcggcatgcttatggag
ggcgtcgctcccgatcaccgacagattcccggcttggagtggctcgctgatggaccgcgt
ctttctcctgactctatcgtgtacgtgggtttgcgggacgtcgatccggcagagcggagg
ttgattcaatccctggatattgcggcttacacgatgcacgaaattgatcggtatgggatt
ggtcaagttatggaaatggctttggatcacttgtgcgccaaaaatccaaaccgcccactg
catttgagttacgacatcgatgcggtcgatcctgtcttggcacccgcaacgggaacaact
gtccgtggtggtttgacttttcgggaggcgcactatgtggcagaagcggtggcctatacg
ggcaaccttgccagcgccgaaattgtagaactcaatccttcattatcctgtggcgaaggc
gcggaagctacagtcgagctaggcttacagcttattacatctttcatgggcaaaagcatt
atttaa

DBGET integrated database retrieval system