KEGG   Phaeodactylum tricornutum: PHATRDRAFT_38509Help
Entry
PHATRDRAFT_38509  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pti01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pti00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
16
AA seq 301 aa AA seqDB search
MTYGQPFVGTDSGPELLRQAGLRKMLSALGWRVEDVPDLEFEALQLSEKSGTFEGNAKNH
KLVGAGCEMLANAVEKTLKQKRFPLILGGDHSIGMGSLAGILRAQPETGVIWIDAHADLN
TPALSESGNMHGMPVGMLMEGVAPDHRQIPGLEWLADGPRLSPDSIVYVGLRDVDPAERR
LIQSLDIAAYTMHEIDRYGIGQVMEMALDHLCAKNPNRPLHLSYDIDAVDPVLAPATGTT
VRGGLTFREAHYVAEAVAYTGNLASAEIVELNPSLSCGEGAEATVELGLQLITSFMGKSI
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacctacggacagcccttcgtgggcaccgacagtggaccggagcttttgcgtcaagcg
ggattgcgcaagatgttgtccgccttgggatggagagtagaagatgtaccggacttggaa
tttgaagctttgcagctttcggaaaaaagcggaaccttcgagggaaatgcaaaaaaccac
aagctcgtcggtgctggctgtgaaatgctcgccaacgccgtggaaaagacattgaagcaa
aagcgctttcctcttattttaggcggcgaccattctataggtatgggtagtctggccggt
attttgcgtgctcaaccggaaactggggtgatttggattgatgcgcacgctgatttaaac
accccagcgttgagtgaatccggaaacatgcacggcatgcccgtcggcatgcttatggag
ggcgtcgctcccgatcaccgacagattcccggcttggagtggctcgctgatggaccgcgt
ctttctcctgactctatcgtgtacgtgggtttgcgggacgtcgatccggcagagcggagg
ttgattcaatccctggatattgcggcttacacgatgcacgaaattgatcggtatgggatt
ggtcaagttatggaaatggctttggatcacttgtgcgccaaaaatccaaaccgcccactg
catttgagttacgacatcgatgcggtcgatcctgtcttggcacccgcaacgggaacaact
gtccgtggtggtttgacttttcgggaggcgcactatgtggcagaagcggtggcctatacg
ggcaaccttgccagcgccgaaattgtagaactcaatccttcattatcctgtggcgaaggc
gcggaagctacagtcgagctaggcttacagcttattacatctttcatgggcaaaagcatt
atttaa

DBGET integrated database retrieval system