KEGG   Phaeodactylum tricornutum: PHATRDRAFT_3924Help
Entry
PHATRDRAFT_3924   CDS       T01075                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
19
AA seq 325 aa AA seqDB search
MASGDEWCTIESDPGVFTELLEQLGCPRVELQELWSLDEDSLAQLTSSTNRVYGLIFLFQ
WIGETQKEHATTQTPLNEDDIPSNLFFAHQVTTNACATQAILSVVLNADLEEQELGSTLG
TFQSFTASFPPNLKGVAISSSDEIRTAHNAFGRTDAFLHEGKIHKPTGDEEAFHFVAYVP
QSNVLYELDGLQKGPIVVDTVGAEEQEAGATAWLGIARKAIQDRMQQLGGEGSIKFNLMA
VIEDKRVLLESQLADTAESDPQHDLLLSQIRMERDKRELWKAENQRRRHNYVPLCVQLLE
ELARDGSLRGLIEAAKTKLVENRRR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggagatgaatggtgcacgatcgagtccgatcctggtgtctttaccgaactg
ctggagcagcttggttgcccgcgcgttgagctccaggagctttggagtttggacgaagac
tcgctggcgcagctgacttcatccacaaaccgcgtctacggtcttatctttctgtttcaa
tggattggagagacgcagaaagagcacgccacgacgcagacacctttaaatgaagatgat
attccatccaatctgttttttgcccatcaagtcaccactaacgcctgtgcaacgcaagcc
attttatccgtcgtactcaacgccgacttggaggagcaagagctggggtcaaccttgggg
acctttcagtcatttaccgcgtcgtttcctcccaatctcaaaggcgtggctatatctagt
tcggacgaaattcgaaccgcacacaacgcctttgggaggacggacgcatttttgcacgaa
ggcaagatccataagcctaccggcgacgaagaagcctttcattttgtggcgtatgtaccg
cagagcaatgttctctacgagcttgacggtctacagaagggacccatcgtcgttgatacc
gtgggagcagaagaacaggaagctggcgctacggcctggctaggcattgcccgaaaggcc
attcaagatcgtatgcagcaattgggaggtgaaggatcgatcaaatttaacctcatggct
gtaattgaggacaagcgtgtgctgttggagtcccaactggctgatacggccgagtcggat
ccacagcacgatctcttgctgtctcaaatacgaatggaacgcgacaaacgagaattgtgg
aaggcagagaaccagcggcggcgtcacaactacgtccctctctgtgtgcaacttttggaa
gaattggccagggatggatcactccgcggcttaatcgaagctgcaaagacaaagctagtg
gaaaaccgaagacgc

DBGET integrated database retrieval system