KEGG   Phaeodactylum tricornutum: PHATRDRAFT_39432Help
Entry
PHATRDRAFT_39432  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PHATRDRAFT_39432
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PHATRDRAFT_39432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
19
AA seq 791 aa AA seqDB search
MKIPTVLSFLYVGNLLRDAHCSPLPELFAAKSMEEVEALMSKTKQRPAHEVLRGRRRLQD
GTLETSNHILADRFGGEAGFFHSVASGDPLADAVIIWTRYTPVNVDDEITLEFRMAAIDP
NLEVNAHLDPTLNENIKRGKVTVTAASDFTAKIDVTGLPSNTQFVYVFSDGQQVSDIGLT
KTAPAPGDEDPDLIYAFFSCSHFTNGFFHAYDVASTIQDLDLWIHVGDYYYEYGLFDTYA
REAAEQRDQFVLPIWETIDLQDYRNRHSTHVAHDEGLRNLRRRAPMIATWDDHETTNDSY
GNVNQGTGAENHQETCLANATSPDADKAAAQCDRPEGDAVERFTAAAQAYWEWMPIRYVE
GTMGEIQTGTLTQIIEWGDLATIASFDTRMSFRTEESTGASAFATYAAVGAVNTNVSSYS
DPSSDAYAAIQQIRESDRGSRLNESFSMLGDYFDTLEDVFEASKAAGKPWQIWAANTMMG
HYVLPDAAQFYLDAPEEVQAIIQTYFDAFMLSEAALTARLISALRVADIEWNLDDYGGFY
AERAKITEMAKASTNNMVVLGGDLHDAFAWVLVEGGEVEGAPVAINLGCPSVTSPGFKNA
FLPVFSPILEAIGGEDVAIDIMNRGYARANPNLKFSDIGKKGFVAIKATMDTHTAEYIGF
SPETLLTDFATARTDGAITAPFECQISLTTQSDVPGSLEPSETCSAIAFDNERPAVYDLP
VPSLDNMPEGDALTVCGMIGCAFDASTEPTDSASTVTPTAPAPAPASSSTLSIGRSMGLV
TGVLLLIVTLL
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcctactgtcttaagttttctctacgttggcaatctcctccgtgatgcccac
tgcagtcccttacccgagctcttcgctgccaagtccatggaagaagtcgaagccctcatg
tccaagacaaagcaacgccccgctcacgaagttctccgtggacgacgtcgtcttcaagac
ggaactcttgaaacttccaaccacattcttgctgacaggtttggcggagaagctggcttt
ttccattctgttgcttccggtgatccgttggcagatgcagtcatcatctggacgcgttat
actcccgtcaacgtcgacgatgaaattacgttggagtttcgtatggctgctattgatcct
aatctggaggtcaacgcgcacctggatcctacactcaatgaaaacattaagcgtggcaag
gtcacggtcactgctgcgtctgacttcactgccaagattgatgtgacgggattgccttcc
aacacgcagtttgtgtacgtcttttccgacggacagcaggtttccgatatcggtttgacg
aaaaccgccccggccccgggggacgaagatcctgatctcatatacgcttttttctcgtgc
tcccactttactaacggtttcttccacgcctatgacgttgcttcgacaatccaagatttg
gatctgtggattcacgttggcgactattactacgagtatggcctcttcgacacgtatgca
cgcgaagcagctgagcaacgcgatcagtttgttttgcctatttgggaaacaattgactta
caagattaccgcaatcgtcattcgacacatgtggcgcacgatgaaggtcttcgcaatttg
cggcggcgtgctcccatgattgccacgtgggacgatcacgagaccaccaacgacagttat
ggaaacgtcaatcaaggaactggagcggagaaccaccaggaaacttgcctcgctaacgct
acatcacctgatgccgacaaagcagctgcccaatgcgaccgaccggaaggtgatgcggtg
gaacgctttacagctgccgcccaggcgtattgggaatggatgcctattcgatacgtcgaa
ggtaccatgggcgagattcagacaggaacgttgacccaaattattgaatggggcgacttg
gccaccatagcttcctttgatacgcgcatgagctttcgtacggaagagtccacgggagcg
tctgcctttgcaacgtacgccgctgtaggtgcggtgaacacaaatgtgagctcgtactcc
gatccgagctccgatgcctacgctgctatccagcaaatccgagaaagcgatcggggaagc
cgactgaacgagagcttctccatgcttggtgattatttcgacaccttggaagacgtcttt
gaagcttccaaggcggcaggaaaaccttggcaaatctgggctgcaaacacaatgatgggt
cactatgtcttacctgacgcggcacagttttatttggacgcacccgaggaggttcaggcc
atcattcagacatacttcgatgccttcatgctttccgaagccgccttaactgcccgactg
atttcggctctacgcgttgccgacattgaatggaacctcgacgactacggtggtttttac
gctgaacgcgccaagattacagaaatggcaaaggcctcgaccaataacatggtagtactg
ggaggagatctacacgacgcatttgcatgggtgcttgttgagggaggggaagttgagggt
gccccggtggctatcaatctcggctgtccaagtgtgacttccccagggttcaaaaacgct
ttcttaccagtgttcagtccaatcttggaagccattgggggcgaagacgtagccattgat
atcatgaacaggggttacgcacgtgctaatccaaacctcaaattttctgatattgggaag
aagggctttgttgccattaaagcaaccatggacacacacactgccgaatacattggcttc
tcacccgaaacactgctgaccgactttgcaactgctcgcaccgatggagcaatcacggca
ccatttgagtgtcaaatatcactaaccacgcaatctgacgttcccgggtctcttgagcct
agtgagacttgttcagccattgcgtttgacaatgagcgacctgccgtttatgatcttcct
gttccatcgcttgacaatatgcctgaaggcgacgcactcactgtttgtggtatgattggt
tgcgcgtttgatgcctccactgagccgaccgatagcgcttcaacggttacgcctactgca
ccagctcctgctcctgcatcgagctcaaccttaagtattggtcgctcaatgggccttgtt
accggtgtcctattgcttattgttactttattgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system