KEGG   Phaeodactylum tricornutum: PHATRDRAFT_39942Help
Entry
PHATRDRAFT_39942  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PHATRDRAFT_39942
Enzymes [BR:pti01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PHATRDRAFT_39942
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21
AA seq 301 aa AA seqDB search
MKFAVKEIKHTKSGASCRIHEFGATVLSYTSAARREILFVSRDAKLDGSKAVRGGIPLVF
PIFGPPKDESSTMPQHGFARNNVWSTVEGSEFDEDDSAGISYELDFNKVTAGKGTNNSWE
SGCYNVKLILDISITGDALTTILNIHNTGEEAFPFEALFHTYYSIDDHSAMDGSKCFVQG
LEGYNAYDQLTKRNKMIGSEPITIDSELDSIHTPPDGIYIADLLIGVGATETIKLVCSGK
VDGREVPVSVVVWNPHEKKAASMGDFGSDQYVDMLCVEPGLLRGDTLDAGKKATMKQIIA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgcagtcaaggaaatcaagcacaccaaatcgggtgcgtcatgccgcattcat
gagttcggggccactgtgttaagctacacaagcgccgcccgtcgagagattctttttgtg
tctcgcgacgccaaactagatggaagcaaggcagtccgtggaggaattcctctggttttt
cctatatttggacccccaaaagatgaatcttcgactatgcctcaacatggttttgcgcgt
aacaacgtgtggtcaacagtggaaggatccgaattcgacgaagatgattcagcgggaata
tcttacgagctcgatttcaacaaagtaactgctgggaaaggaaccaacaattcatgggaa
agcgggtgctataatgtcaagcttatcttggatatttctattactggtgatgctctcact
acaatcctgaatattcacaacacaggtgaagaagcgttcccgttcgaagcgttgttccat
acgtattactcgatcgacgaccattctgctatggacggcagcaagtgctttgtccaaggt
ttggaaggatacaatgcatacgatcaactgaccaaaagaaataagatgataggcagtgag
cccatcacgatcgactctgaattggatagcattcacacgccacctgatggtatatatatt
gccgatctacttattggagtcggtgcaaccgaaaccatcaagcttgtatgtagtgggaaa
gtggacgggcgggaagtgccggtctcagttgtggtttggaatccgcatgaaaagaaggca
gcctcgatgggagattttggtagcgaccagtacgtcgacatgctctgcgtggagcctggt
cttttgcgaggcgacacgctggatgcaggcaagaaagcaacgatgaagcagataattgct
gcctaa

DBGET integrated database retrieval system