KEGG   Phaeodactylum tricornutum: PHATRDRAFT_40017Help
Entry
PHATRDRAFT_40017  CDS       T01075                                 

Gene name
TYR1
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:pti00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:pti00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21
AA seq 546 aa AA seqDB search
MCSMLLVLFLECHSTTGRTMAATTRKESAQTNDTVRPLGANAFCKNGEKTRIRRDWDLIS
RDDQDLYIEAIEEAIDRELYQAFLGYHADSVALVQSHETCGFALWHRTFLLAFENMLRSL
APRFACLTIPYWNVMEHSSDQARGLCTSYRTCSRIVGDLGGSPVAAAATRLYAGIEATGD
LITGRPIRNLHDDNNATGIVRDDLFWVTLPASTAYDSVLDILVTSPSYVQYTRRIQETIH
DDVHDTLGGFMPTYSSPTDPLFMPWHSFIDLALFMWEACYLDPSEQASGTRLAADWAFEG
AGSNCSRSGRSKVLFPILNATSELYLMRGDFHVLEDPLIGIYFADIGILFSDVASIRDLG
EDFDFTYDHVTERIWNVLQDPSQCPSSGSWTAFPTPSPTTASPVVGSPNDADARSEWLAG
IRQRLEEMFAETHPGYVAQYMSYFTCVTQDETSLSVYTEDPGEYLVDVLNGNAIIRARCA
FFLPETESVTNEELPTSSTPVAAPSENRDQFAGDDEDDDQTSTALRAPQPYFGIGLVSCL
VLLVVD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcaatgcttctcgtactcttccttgaatgccattcgacgactggtaggacaatg
gctgcaacaacaagaaaggaaagtgcacaaaccaacgataccgtgcgaccattgggcgcc
aacgcattttgtaaaaacggggaaaagacaaggattcgacgtgactgggacttgatctct
cgtgacgaccaggacctctacatcgaggcgatcgaagaagcaatagatcgagaattatac
caggctttcttgggctaccatgcggactctgtagcgttagtacaatcgcacgaaacatgt
ggtttcgcattgtggcatcgaacctttctgttagctttcgaaaacatgttgcggtcgctg
gcaccacggtttgcttgtctcactatcccttattggaatgtgatggagcattctagtgat
caagccagaggcttgtgcaccagctatcgaacctgctccagaatagtaggagaccttggt
ggtagtcctgtcgcggcagcagcgacccgtctgtatgccggcattgaggctactggagat
ttgattaccggtcgtccaattcgcaatctccatgatgacaacaacgctactggcatagtg
cgcgatgacttattctgggtcactctgcctgcgagtacagcgtacgatagcgttctcgat
atcctggttactagtccgtcctacgttcaatacacacgtcggatccaggaaaccattcac
gacgatgttcacgacacgttgggtggcttcatgcccacatactcaagccccactgatcca
ctctttatgccgtggcacagctttatcgatcttgctttgttcatgtgggaagcttgctac
ttggatccatcggaacaagcttccggtacgcgtcttgctgcagactgggcgtttgagggc
gccggatcgaactgctcccgaagtggtcgcagtaaggtcctgttccccatcctcaacgcc
acgagcgagctatatcttatgaggggtgactttcatgtgcttgaagatcccttgattgga
atctattttgccgatattggaattcttttctcggatgtggcgtctattcgtgacttggga
gaggactttgatttcacctacgatcacgtgacggagcggatttggaatgtcctgcaagat
ccgtctcaatgtccgtcctcgggatcctggacagcctttccgactccgtcgccgacaacg
gcatcccccgtggtaggatcaccaaacgatgccgatgctcgtagcgaatggctggctggg
atccgtcagcgcctcgaggaaatgtttgccgaaacacacccgggatacgttgcccaatac
atgtcttacttcacctgtgtcacgcaggatgagacaagtctctctgtatacacagaggat
ccgggcgagtacttggttgatgtgttgaatggcaacgcgattattagagcgcgttgcgcc
tttttccttcccgaaacagagtccgttacgaatgaggaattgcccacgtcttcgactcct
gtggctgcgccctctgagaacagggaccagtttgcaggcgacgacgaggatgatgaccag
actagtaccgccctaagagcacctcaaccgtactttggcattgggttggtcagctgcttg
gtgctactcgttgtggactag

DBGET integrated database retrieval system