KEGG   Phaeodactylum tricornutum: PHATRDRAFT_40017Help
Entry
PHATRDRAFT_40017  CDS       T01075                                 

Gene name
TYR1
Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
pti  Phaeodactylum tricornutum
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    PHATRDRAFT_40017 (TYR1)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PHATRDRAFT_40017 (TYR1)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     PHATRDRAFT_40017 (TYR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21
AA seq 546 aa AA seqDB search
MCSMLLVLFLECHSTTGRTMAATTRKESAQTNDTVRPLGANAFCKNGEKTRIRRDWDLIS
RDDQDLYIEAIEEAIDRELYQAFLGYHADSVALVQSHETCGFALWHRTFLLAFENMLRSL
APRFACLTIPYWNVMEHSSDQARGLCTSYRTCSRIVGDLGGSPVAAAATRLYAGIEATGD
LITGRPIRNLHDDNNATGIVRDDLFWVTLPASTAYDSVLDILVTSPSYVQYTRRIQETIH
DDVHDTLGGFMPTYSSPTDPLFMPWHSFIDLALFMWEACYLDPSEQASGTRLAADWAFEG
AGSNCSRSGRSKVLFPILNATSELYLMRGDFHVLEDPLIGIYFADIGILFSDVASIRDLG
EDFDFTYDHVTERIWNVLQDPSQCPSSGSWTAFPTPSPTTASPVVGSPNDADARSEWLAG
IRQRLEEMFAETHPGYVAQYMSYFTCVTQDETSLSVYTEDPGEYLVDVLNGNAIIRARCA
FFLPETESVTNEELPTSSTPVAAPSENRDQFAGDDEDDDQTSTALRAPQPYFGIGLVSCL
VLLVVD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcaatgcttctcgtactcttccttgaatgccattcgacgactggtaggacaatg
gctgcaacaacaagaaaggaaagtgcacaaaccaacgataccgtgcgaccattgggcgcc
aacgcattttgtaaaaacggggaaaagacaaggattcgacgtgactgggacttgatctct
cgtgacgaccaggacctctacatcgaggcgatcgaagaagcaatagatcgagaattatac
caggctttcttgggctaccatgcggactctgtagcgttagtacaatcgcacgaaacatgt
ggtttcgcattgtggcatcgaacctttctgttagctttcgaaaacatgttgcggtcgctg
gcaccacggtttgcttgtctcactatcccttattggaatgtgatggagcattctagtgat
caagccagaggcttgtgcaccagctatcgaacctgctccagaatagtaggagaccttggt
ggtagtcctgtcgcggcagcagcgacccgtctgtatgccggcattgaggctactggagat
ttgattaccggtcgtccaattcgcaatctccatgatgacaacaacgctactggcatagtg
cgcgatgacttattctgggtcactctgcctgcgagtacagcgtacgatagcgttctcgat
atcctggttactagtccgtcctacgttcaatacacacgtcggatccaggaaaccattcac
gacgatgttcacgacacgttgggtggcttcatgcccacatactcaagccccactgatcca
ctctttatgccgtggcacagctttatcgatcttgctttgttcatgtgggaagcttgctac
ttggatccatcggaacaagcttccggtacgcgtcttgctgcagactgggcgtttgagggc
gccggatcgaactgctcccgaagtggtcgcagtaaggtcctgttccccatcctcaacgcc
acgagcgagctatatcttatgaggggtgactttcatgtgcttgaagatcccttgattgga
atctattttgccgatattggaattcttttctcggatgtggcgtctattcgtgacttggga
gaggactttgatttcacctacgatcacgtgacggagcggatttggaatgtcctgcaagat
ccgtctcaatgtccgtcctcgggatcctggacagcctttccgactccgtcgccgacaacg
gcatcccccgtggtaggatcaccaaacgatgccgatgctcgtagcgaatggctggctggg
atccgtcagcgcctcgaggaaatgtttgccgaaacacacccgggatacgttgcccaatac
atgtcttacttcacctgtgtcacgcaggatgagacaagtctctctgtatacacagaggat
ccgggcgagtacttggttgatgtgttgaatggcaacgcgattattagagcgcgttgcgcc
tttttccttcccgaaacagagtccgttacgaatgaggaattgcccacgtcttcgactcct
gtggctgcgccctctgagaacagggaccagtttgcaggcgacgacgaggatgatgaccag
actagtaccgccctaagagcacctcaaccgtactttggcattgggttggtcagctgcttg
gtgctactcgttgtggactag

DBGET integrated database retrieval system