KEGG   Phaeodactylum tricornutum: PHATRDRAFT_40430Help
Entry
PHATRDRAFT_40430  CDS       T01075                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61 2.3.1.12)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pti  Phaeodactylum tricornutum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PHATRDRAFT_40430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PHATRDRAFT_40430
  Amino acid metabolism
   00310 Lysine degradation
    PHATRDRAFT_40430
Enzymes [BR:pti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PHATRDRAFT_40430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
23
AA seq 377 aa AA seqDB search
MGDSISEGTIVDLPVAPGDFVNVDDVVVVLETDKVSVDVRAPEAGALVEILGEIDDVVEV
GTNLFRIDTDADAPEAPVAPESTPEEVATHIAEPAPSQTPTSAPVAAASAATKAPPPPPA
AKSAPPSAPSGAPASQPVFLGTRNERRTKMSRMRQRVAARLKDAQNTAAMLTTFQEVDMG
NLMELRKRYKDVFQEKHGVKLGFMSAFVKATTAALQEIPAVNGYIDNDTQEIVYREFVDI
SVAVASPNGLVVPVLRNTETMSFADVERNIAAYGQKAKEGSLSLDDMAGGTFTISNGGVF
GSLMGTPIINPPQSAILGMHATKMRAVVNEQGEVVARPMMYLALTYDHRLIDGREGVTFL
KSIAEKIADPSKLLLEI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacagtatttccgaaggcacgattgtagatttgcccgtggcgccgggtgatttc
gtcaacgtggacgacgttgtcgtcgtcttggaaacggacaaggtttccgtcgacgtgcgt
gccccggaagccggtgccttggtcgaaatcctcggtgaaatcgacgacgttgtcgaagtg
ggtaccaacctctttcggatcgacaccgatgcggatgcaccggaagcccccgtggcgcct
gaatccactccggaagaagtcgcgacgcacattgccgaacccgcaccgtcccaaactcca
acgtccgcgcccgtggcggcggcgtccgccgccaccaaggcgccaccaccaccacccgcc
gccaagtctgcaccgccgtccgctccctccggcgcccccgcgtcccaacccgtctttttg
gggacccgcaacgaacgtcgcaccaaaatgagtcgcatgcgtcagcgcgtcgcggcgcga
ctcaaggatgcacaaaataccgccgccatgctcaccacctttcaagaagtcgatatgggt
aacctcatggaactccgtaagcggtacaaggatgtcttccaagaaaagcacggcgtcaag
ttgggattcatgagcgcttttgtcaaagccaccacggcggctttgcaggaaattcccgcc
gtcaacggctatatcgacaacgacacgcaagaaattgtttaccgcgaatttgtggacatt
tccgtagccgtggcctcgcccaacgggttggttgtgcccgtcttgcgcaataccgagacc
atgagctttgccgacgtggaacgcaacattgccgcctacggacaaaaagccaaggaaggg
tccctcagtttggacgacatggctggtggtacttttaccatttccaacggcggtgtcttt
ggatcgctgatgggaacccccattatcaatccgccacaatcagccattttgggaatgcac
gcgaccaagatgcgggcagtcgtcaacgaacaaggcgaagtggtggcgcgccccatgatg
tacctcgccttgacgtacgatcatcgattgattgatggcagagaaggtgtcaccttcttg
aagtccatcgccgagaagattgcggatccctccaagctgttgctggaaatctaa

DBGET integrated database retrieval system