KEGG   Phaeodactylum tricornutum: PHATRDRAFT_41702Help
Entry
PHATRDRAFT_41702  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHATRDRAFT_41702
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHATRDRAFT_41702
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHATRDRAFT_41702
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHATRDRAFT_41702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 671 aa AA seqDB search
MERGVGGRIEDAFAAAKEQGEAAFVTFVTAGYPTAADTPAILMAMQEGGAALIELGIPYT
DPQADGATIQHTNQVAIKGGTSEIHQCLDMVKKSREMGLTVPVVLMGYYNPFLQYDVDKL
CEETKAAGADGFIVVDLPPEEGIALNKACIANGLSNIPLVAPTSSDKRIASLTDMASTFL
YCVSVTGVTGARESLPPDLEEFITRVRSKTELPLAVGFGISNPEMVNGVANMADGVVVGS
AILKAMDSLGDTATTEQRADAIRESTKLGQIPAEWTLGENNSRFGKFGGQYIPETLSVAF
EEIEASYNELKDDPSFLAELDEYRRDFVGGPTPLHRADRLTELAGGATIWLKREDLAHTG
AHKINNAIGQALLAKRIGKPRIIAETGAGQHGVATATICAKLGLDCTVYMGAVDCERQKL
NVFRMNTLGAKVVPVQDGQRTLKDAINEAMRDWVTNVRDTHYLIGSAVGPHPFPTIVRDF
QSVMGREMRAQMLERAGKLPDAVVACVGGGSNAIGAFHPFVNDETVELHGVEAAGYGIDK
DEEHCATLTKGTPGVLQGAMTYVIQQKSGQTLNTHSISAGLDYPGVGPEHAFLKDSGRAV
YEAVTDDEALEGFKLMCEYEGIIPALETSHAIYYAVKLAKKLGPGKDIVINMSGRGDKDM
PQIAKIMGVEV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtggtgttggtggacgtatcgaggatgcctttgcggccgcgaaggaacagggc
gaagcggcctttgtgacgtttgtcaccgccggttatccgactgctgctgatacgccagcg
attctcatggccatgcaggaaggtggggcggcgttgattgaacttggaattccgtacaca
gatccgcaggccgacggagctacgatccagcacaccaatcaagtagcaatcaagggaggg
acgtcggagattcaccagtgtctcgacatggtaaagaaatctcgcgaaatgggattaact
gtgcccgtggttctcatgggatactacaaccccttccttcagtacgatgtagacaagctt
tgcgaagaaaccaaggctgccggagccgatggtttcatcgttgtcgatcttcctcccgaa
gagggtattgccttgaataaggcttgcattgccaatgggctttccaatattcccttggta
gcacctacttcgagtgacaagcgtattgcttccttgacagacatggcttctacctttcta
tactgcgtatcagttacaggagtaactggcgcgcgtgaatcccttcctccggatctggag
gagttcattacacgcgtacgttccaagacggaactacctttagcggtcggtttcggtatt
tcaaatcctgaaatggtaaatggtgttgccaacatggccgatggtgttgtggtgggtagt
gcgattttgaaggctatggattcgcttggagacactgctaccaccgaacagcgtgccgat
gcaattcgtgagtcaactaaacttggtcaaatcccagcggaatggactctgggcgagaac
aacagccgattcgggaagtttggcgggcagtacattccagaaaccctttcggtcgccttc
gaagaaattgaagcgtcctacaatgagctgaaggacgacccatccttccttgctgaactc
gacgaataccgacgggactttgttggtggtccgacgcctttacacagagcggaccgcctg
acggaacttgccggaggcgcgacgatctggttaaagcgcgaagacttggcacatacggga
gctcacaagatcaacaatgcaattgggcaagccttgcttgccaagcgaattggaaaaccg
cgtatcattgccgaaacgggtgctggacaacatggagtcgccactgcaacaatttgcgcc
aagctcggcctcgattgcactgtctacatgggagcggttgattgtgagcgtcaaaagctt
aacgttttccgcatgaacactctcggtgccaaggtggtacctgtacaagatgggcaacgg
actttaaaggatgccatcaacgaagcgatgcgcgattgggtcaccaacgttcgcgatacg
cattacttgattggttccgctgtcgggcctcatccattcccaacgattgtacgtgacttt
caaagcgtaatgggtcgcgagatgcgtgcccagatgcttgaaagggccggaaagcttcca
gacgctgttgtggcgtgtgtcgggggtggatcgaatgccataggagctttccatcctttc
gttaatgacgagactgttgagcttcacggagtggaagcggcaggctacgggatcgacaaa
gacgaagaacattgcgcgactctcaccaagggaacacccggggtactccagggagccatg
acatacgttattcagcaaaagtccggtcaaacgctcaacacacactcaatctctgcgggt
cttgactatccaggtgttggtccggagcacgctttcttgaaagatagtggacgagctgta
tacgaggcagtcacagatgatgaagcactggagggctttaaattgatgtgtgaatatgaa
ggtatcatcccggcccttgaaacgagccatgctatctactatgcggtcaagctcgcgaaa
aagctcggccctggcaaggacattgtaatcaacatgagtggtcggggagacaaggacatg
ccgcagatcgcgaagattatgggcgtcgaagtttaa

DBGET integrated database retrieval system