KEGG   Phaeodactylum tricornutum: PHATRDRAFT_41702Help
Entry
PHATRDRAFT_41702  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
pti  Phaeodactylum tricornutum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PHATRDRAFT_41702
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PHATRDRAFT_41702
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PHATRDRAFT_41702
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PHATRDRAFT_41702
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 671 aa AA seqDB search
MERGVGGRIEDAFAAAKEQGEAAFVTFVTAGYPTAADTPAILMAMQEGGAALIELGIPYT
DPQADGATIQHTNQVAIKGGTSEIHQCLDMVKKSREMGLTVPVVLMGYYNPFLQYDVDKL
CEETKAAGADGFIVVDLPPEEGIALNKACIANGLSNIPLVAPTSSDKRIASLTDMASTFL
YCVSVTGVTGARESLPPDLEEFITRVRSKTELPLAVGFGISNPEMVNGVANMADGVVVGS
AILKAMDSLGDTATTEQRADAIRESTKLGQIPAEWTLGENNSRFGKFGGQYIPETLSVAF
EEIEASYNELKDDPSFLAELDEYRRDFVGGPTPLHRADRLTELAGGATIWLKREDLAHTG
AHKINNAIGQALLAKRIGKPRIIAETGAGQHGVATATICAKLGLDCTVYMGAVDCERQKL
NVFRMNTLGAKVVPVQDGQRTLKDAINEAMRDWVTNVRDTHYLIGSAVGPHPFPTIVRDF
QSVMGREMRAQMLERAGKLPDAVVACVGGGSNAIGAFHPFVNDETVELHGVEAAGYGIDK
DEEHCATLTKGTPGVLQGAMTYVIQQKSGQTLNTHSISAGLDYPGVGPEHAFLKDSGRAV
YEAVTDDEALEGFKLMCEYEGIIPALETSHAIYYAVKLAKKLGPGKDIVINMSGRGDKDM
PQIAKIMGVEV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtggtgttggtggacgtatcgaggatgcctttgcggccgcgaaggaacagggc
gaagcggcctttgtgacgtttgtcaccgccggttatccgactgctgctgatacgccagcg
attctcatggccatgcaggaaggtggggcggcgttgattgaacttggaattccgtacaca
gatccgcaggccgacggagctacgatccagcacaccaatcaagtagcaatcaagggaggg
acgtcggagattcaccagtgtctcgacatggtaaagaaatctcgcgaaatgggattaact
gtgcccgtggttctcatgggatactacaaccccttccttcagtacgatgtagacaagctt
tgcgaagaaaccaaggctgccggagccgatggtttcatcgttgtcgatcttcctcccgaa
gagggtattgccttgaataaggcttgcattgccaatgggctttccaatattcccttggta
gcacctacttcgagtgacaagcgtattgcttccttgacagacatggcttctacctttcta
tactgcgtatcagttacaggagtaactggcgcgcgtgaatcccttcctccggatctggag
gagttcattacacgcgtacgttccaagacggaactacctttagcggtcggtttcggtatt
tcaaatcctgaaatggtaaatggtgttgccaacatggccgatggtgttgtggtgggtagt
gcgattttgaaggctatggattcgcttggagacactgctaccaccgaacagcgtgccgat
gcaattcgtgagtcaactaaacttggtcaaatcccagcggaatggactctgggcgagaac
aacagccgattcgggaagtttggcgggcagtacattccagaaaccctttcggtcgccttc
gaagaaattgaagcgtcctacaatgagctgaaggacgacccatccttccttgctgaactc
gacgaataccgacgggactttgttggtggtccgacgcctttacacagagcggaccgcctg
acggaacttgccggaggcgcgacgatctggttaaagcgcgaagacttggcacatacggga
gctcacaagatcaacaatgcaattgggcaagccttgcttgccaagcgaattggaaaaccg
cgtatcattgccgaaacgggtgctggacaacatggagtcgccactgcaacaatttgcgcc
aagctcggcctcgattgcactgtctacatgggagcggttgattgtgagcgtcaaaagctt
aacgttttccgcatgaacactctcggtgccaaggtggtacctgtacaagatgggcaacgg
actttaaaggatgccatcaacgaagcgatgcgcgattgggtcaccaacgttcgcgatacg
cattacttgattggttccgctgtcgggcctcatccattcccaacgattgtacgtgacttt
caaagcgtaatgggtcgcgagatgcgtgcccagatgcttgaaagggccggaaagcttcca
gacgctgttgtggcgtgtgtcgggggtggatcgaatgccataggagctttccatcctttc
gttaatgacgagactgttgagcttcacggagtggaagcggcaggctacgggatcgacaaa
gacgaagaacattgcgcgactctcaccaagggaacacccggggtactccagggagccatg
acatacgttattcagcaaaagtccggtcaaacgctcaacacacactcaatctctgcgggt
cttgactatccaggtgttggtccggagcacgctttcttgaaagatagtggacgagctgta
tacgaggcagtcacagatgatgaagcactggagggctttaaattgatgtgtgaatatgaa
ggtatcatcccggcccttgaaacgagccatgctatctactatgcggtcaagctcgcgaaa
aagctcggccctggcaaggacattgtaatcaacatgagtggtcggggagacaaggacatg
ccgcagatcgcgaagattatgggcgtcgaagtttaa

DBGET integrated database retrieval system