KEGG   Phaeodactylum tricornutum: PHATRDRAFT_41928Help
Entry
PHATRDRAFT_41928  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 232 aa AA seqDB search
MSKQKWFPLESNPSLMNEYVAKLGFNTDLYEFVDVFSTEDWALQMIPQPVVAVLMLYPLT
EKQESFYGQDNLAPQDMDKVWFTKQRIGNACGTIGLLHTLLNVPEPLRIFPSDSWLHGFL
EDCPNPLDPVRKAEILERDAKIAKLHDQATSAENNQTDRGNLDDQLVTHFVALVNVNDQL
YELDGRKEAPVAHGPTTSATLLADACKVVQTFMQRDPDEVRFTILALAPKQE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcaaaaatggtttcccctggaatcaaacccttccttgatgaacgaatacgta
gccaagctcggattcaacacggatctttacgagttcgttgacgttttttctaccgaagac
tgggccttacagatgataccacaaccggtcgttgccgttcttatgctgtacccccttacc
gaaaagcaagaatcgttctacggccaggacaatctcgcaccgcaagatatggataaagtc
tggtttacaaaacagcgcatcgggaatgcttgtggtaccattggccttttgcacacactg
ctcaacgtccccgagccgctacgaatctttccatctgattcttggttacacggattttta
gaagattgccccaatccactggatcccgttcgcaaagccgagattctcgaacgcgatgcc
aaaattgccaagctccacgatcaagcgacttcggcggaaaacaaccaaactgatcggggt
aatctcgacgatcagcttgtcactcattttgtggcacttgtcaacgtgaatgatcaactc
tacgaactcgatggtcgtaaagaagcgcccgtcgcgcacggaccgacgacatcggcgacg
ttgctggcggacgcctgtaaagtcgtgcagacctttatgcaacgggatcccgatgaagta
cggtttacaatcctcgcgttggcgccaaagcaagaatag

DBGET integrated database retrieval system