KEGG   Phaeodactylum tricornutum: PHATRDRAFT_43204Help
Entry
PHATRDRAFT_43204  CDS       T01075                                 

Gene name
DXR
Definition
1-deoxy-d-xylulose-5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pti  Phaeodactylum tricornutum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PHATRDRAFT_43204 (DXR)
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     PHATRDRAFT_43204 (DXR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 483 aa AA seqDB search
MRLTELSVSLIVGSAAAFAPTTGISATRTTSASTVRLQLVSGSQGTGEGWIDPSAPVNSK
ASLEKTLSKSLEGSNFQKRLSLLGSTGSIGTQTLEIVDACPDNFVVDALSAGTNVELMTQ
QVLKYSPKVASMSTPEAAKELKRRLQDEGCKSMPLILSGQEGIVAAATVDTADTVVTGIV
GAAGLEPTIEAIKMKKDIALANKETLISGGPVINPLVEKYGINMLPADSEHSAIFQCLQG
VPPGGLRRVILTASGGAFRDFSKDELFRLCEDNPRAVQAKATTHPNWDMGAKITLDSATM
MNKGLEVIEAHYLFGASYDDIDIVIHPQSIVHSMVETQDTSCIAQLGWADMRLPLVYSVS
WPHRLKMPYKPLDLAELGSLTFSKPDHAKYPCIGLAYAAGRQGGTMTAVLNAANEAANEM
FRADVGLGFLDIPKLIEGAMEAHKEEFKKDGVTLEDILHVDQWAREHVRQASEQLDKSKV
IVV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcggttaacggaactgtcagtctctcttatcgtcggttcggcggcagcctttgccccg
acaactggtatctccgcgacgcggacgacttcggcctcgactgtacgcttgcaattagtc
tccggttcccaaggcaccggcgaagggtggattgatccttcggctcccgtcaattccaaa
gcttctttagaaaaaacgctgtccaagtctttggaaggcagcaatttccagaaacggctt
tcgcttttgggttccaccggatcgattgggacccagacactcgaaatcgtcgacgcttgc
cctgacaactttgtcgttgatgcgctttcggcgggtaccaatgtagagctcatgacacag
caagtgctcaagtactctcccaaagtcgcgtccatgagtaccccggaagcagccaaggaa
ttgaaacgacgtctccaagacgaagggtgtaaatccatgccactgatcctttccgggcag
gagggcattgtcgcagccgcgacggtcgacactgccgatacagtagtcactggaattgta
ggtgcggctggtttggaacccaccatcgaagccatcaaaatgaaaaaagacattgcgttg
gccaacaaagaaactttaatttccggcggacccgtcattaatccactcgtggaaaaatac
ggaatcaacatgctccctgccgacagtgagcacagtgccattttccagtgcttgcagggt
gtccccccgggtggattgcggcgtgtcattttgacggcatccggtggtgcctttcgggat
ttttccaaagacgagctctttcgtctctgcgaagacaaccctcgtgccgtgcaggccaag
gccacgacacaccccaactgggatatgggtgcgaaaattaccctcgacagtgccactatg
atgaacaagggcctcgaagttatcgaggcccattacttgttcggtgccagctacgacgat
attgatatcgtgattcatccccaatcgatcgtacattcgatggtcgaaacacaggatact
tcctgcattgcccaattgggttgggccgacatgcgtctgccgttggtatattctgtgtcc
tggccccaccgattgaaaatgccgtataaaccgttggatttggccgagcttggctcttta
acgtttagcaaacccgaccacgccaagtatccttgtattgggctggcgtacgcagccggt
cgacaggggggtaccatgacggcggtcctgaacgcggccaacgaagccgccaacgaaatg
ttccgcgccgacgtcggtctcggctttttggatatacccaagctgattgaaggtgctatg
gaagcacacaaggaagaattcaaaaaggatggtgtcacgttggaagatattctgcacgtg
gatcaatgggctcgcgagcacgtgcgtcaagcgagtgaacagctggacaagagtaaagtt
attgtagtatag

DBGET integrated database retrieval system