KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44531Help
Entry
PHATRDRAFT_44531  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 299 aa AA seqDB search
MKQTQLWSVLYSSCCIISAVRAFNDPVPQSLKLPQPPGPVMRAWTCHGRTQAELVDRLTQ
ANIVQSPLVQSVLQAVDRANYVPNDPYMDAPQAIGQGQTISAPHMHAYALEALLPCLQQQ
KQHPEQQRDLRILDVGCGSGYLTACMGRWLHSRNPQEPPLLAKGQVYGIDIHADLVDQTR
RNMQLGDADLLSSGTVQLSESNGWNGWPVAAPFDAIHVGAAAAEFPRTLATQLSVGGCMV
VPIGPQGGAQHLYKVTRLRGHGDSQTDANLQAPSFVMQDFEVSQLLGVRYVPLVEGPKH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacccagctttggagtgtcctttattcgagctgttgtatcatttcggccgtc
cgagcctttaacgatcctgttccccagtctctgaagcttcctcaaccaccaggtccagtc
atgcgtgcctggacgtgtcacggtcgcacacaagcggaacttgtcgaccgcttgacgcag
gccaacattgtgcagagtccgctcgttcaaagcgtcttgcaggcggtcgatcgagccaac
tacgtacccaacgatccctacatggacgctccgcaagcaattggtcagggtcagactatt
tcggcaccccacatgcacgcatacgccctcgaagctctcttgccttgtctccagcagcaa
aagcagcatccagaacagcaacgagacctccgtattctcgatgtcggctgcggaagtggc
tatctgacagcctgcatgggacgttggctgcactctcggaatccgcaagaaccgccccta
ctggccaaaggacaggtttacggaattgacattcacgcagatttggtcgaccaaacgcga
cgcaacatgcaactaggggatgccgatttgctgtcctccggaacggttcaactgagcgag
tcgaacggctggaatggttggccagtggcggcaccgtttgacgccattcacgtaggggct
gcggcggctgaatttccccggaccctggcgacgcagctcagcgtgggtggttgcatggtg
gtgccgattggaccgcaagggggtgcccaacatttgtacaaggtcacacgcctacgagga
cacggcgattcccagaccgatgcgaatttacaagctccgtcttttgtcatgcaggatttt
gaagtatcgcaattgttaggtgtacggtatgttccgttggtggaaggaccgaaacactga

DBGET integrated database retrieval system