KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44531Help
Entry
PHATRDRAFT_44531  CDS       T01075                                 

Definition
(RefSeq) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PHATRDRAFT_44531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_32 Methyltransf_31 Methyltransf_25 Methyltransf_23 MTS CheR Methyltransf_11 Methyltransf_12 PrmA Ubie_methyltran
Motif
Other DBs
NCBI-GeneID: 7198066
NCBI-ProteinID: XP_002178584
JGI: 44531
UniProt: B7FUF2
Position
4
AA seq 299 aa AA seqDB search
MKQTQLWSVLYSSCCIISAVRAFNDPVPQSLKLPQPPGPVMRAWTCHGRTQAELVDRLTQ
ANIVQSPLVQSVLQAVDRANYVPNDPYMDAPQAIGQGQTISAPHMHAYALEALLPCLQQQ
KQHPEQQRDLRILDVGCGSGYLTACMGRWLHSRNPQEPPLLAKGQVYGIDIHADLVDQTR
RNMQLGDADLLSSGTVQLSESNGWNGWPVAAPFDAIHVGAAAAEFPRTLATQLSVGGCMV
VPIGPQGGAQHLYKVTRLRGHGDSQTDANLQAPSFVMQDFEVSQLLGVRYVPLVEGPKH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaacccagctttggagtgtcctttattcgagctgttgtatcatttcggccgtc
cgagcctttaacgatcctgttccccagtctctgaagcttcctcaaccaccaggtccagtc
atgcgtgcctggacgtgtcacggtcgcacacaagcggaacttgtcgaccgcttgacgcag
gccaacattgtgcagagtccgctcgttcaaagcgtcttgcaggcggtcgatcgagccaac
tacgtacccaacgatccctacatggacgctccgcaagcaattggtcagggtcagactatt
tcggcaccccacatgcacgcatacgccctcgaagctctcttgccttgtctccagcagcaa
aagcagcatccagaacagcaacgagacctccgtattctcgatgtcggctgcggaagtggc
tatctgacagcctgcatgggacgttggctgcactctcggaatccgcaagaaccgccccta
ctggccaaaggacaggtttacggaattgacattcacgcagatttggtcgaccaaacgcga
cgcaacatgcaactaggggatgccgatttgctgtcctccggaacggttcaactgagcgag
tcgaacggctggaatggttggccagtggcggcaccgtttgacgccattcacgtaggggct
gcggcggctgaatttccccggaccctggcgacgcagctcagcgtgggtggttgcatggtg
gtgccgattggaccgcaagggggtgcccaacatttgtacaaggtcacacgcctacgagga
cacggcgattcccagaccgatgcgaatttacaagctccgtcttttgtcatgcaggatttt
gaagtatcgcaattgttaggtgtacggtatgttccgttggtggaaggaccgaaacactga

DBGET integrated database retrieval system