KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44610Help
Entry
PHATRDRAFT_44610  CDS       T01075                                 

Gene name
HemD
Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pti00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 296 aa AA seqDB search
MWLVVVLVGIVTSTSNAYEFSLPRIPRRSKSLSPRLAMTSTSSAEDSIAVAVTREDGNNK
KLLKALESRLAGRISVLEVPCIAHADGEDYALLAEKLRSERWDYVAVTSPQAAIILNSAW
DSVRDDPIPVTAVGKATSEALEEYGIAVSFCPSKAIATTLMLELPATRVTDATRVLYPAS
AKARTTLENGLRERGFEVVRLNAYDTVSAHWTHIQRTNAEKCQVACFGSPSAVDGWLRNS
NNNTTVLAACIGKTSADVCRDRGWPKECIFFPDKPGIEGWINVVEEAVDALVSETV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttgtcgtcgtcttggtgggaatcgtcacgtccacatcaaatgcgtacgagttc
tcgttgccgagaattcctcgacgatcgaaatctctctcgccccgactcgcgatgactagt
accagctctgcagaagacagtattgctgttgctgtgacacgcgaagacggaaacaataag
aagctgttgaaagccttggaatctcgattggccggacgtatttcagttcttgaagtgcct
tgtattgcccatgctgatggggaagactatgccttgcttgctgaaaaattacgatcggag
cgatgggattatgtcgccgtcacctctcctcaagcagctattattttgaacagtgcttgg
gatagtgtacgagacgaccctattccagtcacggccgtgggaaaggccacatcagaggct
ttagaagagtacggcatcgccgtttccttttgcccgtccaaggctattgcgaccacgctc
atgctggagcttcctgctactagagtaactgatgcgacacgagttctatatccagcgagt
gccaaagcgcgaacaacgttggagaatggtctcagggaacgaggctttgaagttgtacgt
cttaacgcgtatgacacagtttcggcacattggacgcatatacaaaggacaaatgcagag
aagtgtcaagttgcctgctttgggtcgccgtcggcagtggatggttggctgaggaactcc
aacaacaataccacagttttggctgcttgtataggtaaaacgagtgctgacgtttgtcgc
gacagaggttggccgaaagaatgcattttcttcccagacaagccaggtatcgaaggatgg
atcaatgtcgtagaagaagccgttgacgccctagtcagcgagacagtatag

DBGET integrated database retrieval system