KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44610Help
Entry
PHATRDRAFT_44610  CDS       T01075                                 

Gene name
HemD
Definition
uroporphyrinogen-iii synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pti  Phaeodactylum tricornutum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PHATRDRAFT_44610 (HemD)
Enzymes [BR:pti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PHATRDRAFT_44610 (HemD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4
AA seq 296 aa AA seqDB search
MWLVVVLVGIVTSTSNAYEFSLPRIPRRSKSLSPRLAMTSTSSAEDSIAVAVTREDGNNK
KLLKALESRLAGRISVLEVPCIAHADGEDYALLAEKLRSERWDYVAVTSPQAAIILNSAW
DSVRDDPIPVTAVGKATSEALEEYGIAVSFCPSKAIATTLMLELPATRVTDATRVLYPAS
AKARTTLENGLRERGFEVVRLNAYDTVSAHWTHIQRTNAEKCQVACFGSPSAVDGWLRNS
NNNTTVLAACIGKTSADVCRDRGWPKECIFFPDKPGIEGWINVVEEAVDALVSETV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtggcttgtcgtcgtcttggtgggaatcgtcacgtccacatcaaatgcgtacgagttc
tcgttgccgagaattcctcgacgatcgaaatctctctcgccccgactcgcgatgactagt
accagctctgcagaagacagtattgctgttgctgtgacacgcgaagacggaaacaataag
aagctgttgaaagccttggaatctcgattggccggacgtatttcagttcttgaagtgcct
tgtattgcccatgctgatggggaagactatgccttgcttgctgaaaaattacgatcggag
cgatgggattatgtcgccgtcacctctcctcaagcagctattattttgaacagtgcttgg
gatagtgtacgagacgaccctattccagtcacggccgtgggaaaggccacatcagaggct
ttagaagagtacggcatcgccgtttccttttgcccgtccaaggctattgcgaccacgctc
atgctggagcttcctgctactagagtaactgatgcgacacgagttctatatccagcgagt
gccaaagcgcgaacaacgttggagaatggtctcagggaacgaggctttgaagttgtacgt
cttaacgcgtatgacacagtttcggcacattggacgcatatacaaaggacaaatgcagag
aagtgtcaagttgcctgctttgggtcgccgtcggcagtggatggttggctgaggaactcc
aacaacaataccacagttttggctgcttgtataggtaaaacgagtgctgacgtttgtcgc
gacagaggttggccgaaagaatgcattttcttcccagacaagccaggtatcgaaggatgg
atcaatgtcgtagaagaagccgttgacgccctagtcagcgagacagtatag

DBGET integrated database retrieval system