KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44745Help
Entry
PHATRDRAFT_44745  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PHATRDRAFT_44745
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATRDRAFT_44745
Transcription machinery [BR:pti03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PHATRDRAFT_44745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 1075 aa AA seqDB search
MKSFLLKQQFPDHDKALRHAEDSLEAFESKSNHGVPDTLVRQACACPHLREVLPDALQLD
YVETSTGNFVLANPVHSLHLTAHLDAAWLKALKEEPIMYGEEQERMMAVRTPGLAETFHP
WLKSQTLIPFQRTRVESETDSVKASASVEPPPHSSNKDDLEKAKVPIAAGVPVQKSLDAQ
STETTATLADVTSSGGDSISRTMLPPDSLTKELLKKSASGAVEAKELSLSNPETSLSNEK
SKLPLASAPLVSETAQVAIPASIPSSAGKLQPPVTQDSIASPSMTHTSNTATSIPKPISV
KTDQGLPSLASPAQDANHLSDTRFWSLQAQEDQIRILHRALLSKRTAALAKSKTSASIST
AGSPATKKRKAESKAVSISSLSAWKHYENNVPTAVLTPDEEDDYHDQMTAATRKVEKWME
HYRLARESYWQMRKQSGMGIETSQTRPFGAMDDDSEAGVDTGGLLCRQCFSNEPSWMPSL
SGKPKIRQICRGDQLMRCLECTFVGCGPSSTAPSSEQHILRHFLLSNHKLGVTCGREARV
YCLQCGDFVYHEIFDHERDRVDLATKLPWQAWKPHPVQRSFDALQFMRIQDQGIFWRGMI
AAFPPLVPIEHVRAAQFCRLRQVLFSGEWDLLPLMTSSTAKSFARAQWEKPIFQRGRILA
PVGMYNLGNTCYQSAVLQCLVNCAPVQKYFLEQVGHHHSSCQMYRKTAGRSMSSASSSKS
KAHSVCLACEIDKILLDYVGSSMGIDVRQALLDVCLPERRIFLQASTKKASSTFNTPIKQ
GEPLAPTEMLAATWVCKGMEHLAGYEQRDAHEFLHGFLEALGKHTQLYREKMYKMISTVQ
PSNALMPLENPIEHDFVKKTFEGKLRSVLICQECGSKRTQLESFLSISLPLSSEVQRVTT
ALPGDSDPYIANGKLSVERCLRHFTLPELLSAPIDCPSCKKKTQTKKQHVVSKLPNVLCL
HLKRFDAAQNKKIEDFVAFPARNLNMGPYLPHWCEVTSAPEIGGNSLQSAQVMYSLFATV
NHFGNLQSGHYVANVKVNEKWFHCNDAHVAQAGIGIGEREVLQSNAYLLFYIRSK
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcctttttgttgaagcagcagtttccggaccacgataaggcactacggcacgcg
gaggattccttggaagccttcgaatccaagagcaatcacggcgttccggacactctcgtt
cgacaagcttgcgcttgtccccatctgcgggaagtgctccctgatgcgctacagctcgat
tacgtggaaacatccacgggcaattttgtactggcgaatccggtacacagtttgcatcta
acagcgcatctggatgccgcctggctcaaggctctgaaagaggagcccatcatgtacggg
gaagaacaagaacggatgatggctgtgcgcacacccggactcgccgagacctttcatccg
tggctcaaatcgcagacactgattccgtttcagcggaccagagtggaaagcgaaacggac
tcggtcaaagcatcagcatcagtggaaccccctcctcactcatccaataaggacgacctg
gaaaaggcaaaggttcccatagcagcgggagttcctgttcagaagtctctagatgcacag
tctaccgaaacgaccgctacccttgcagatgtcacttcctccggtggcgatagtatttcc
cgtacgatgctccctccagactcccttacaaaagaactcttgaagaagagtgcgagtggt
gcagtggaagcgaaggagctgtctttgtcgaatcctgaaacaagtctttccaacgaaaaa
agtaaactccctttggcaagcgctcccttggtcagtgagacagcccaagtcgctattcct
gcgtccatcccctcgtccgcaggcaaattacagccgccggtaacccaggactcaatcgct
tcgccctcgatgacacatacttcaaataccgcgacatcaatacccaagcctatttcggtc
aagacggatcagggtctcccctcgttagcgtcgccggctcaggacgccaatcatttaagc
gatactcggttttggtccctccaagcacaagaggatcaaatccgcattctgcaccgcgct
ctgttgtcgaaacgcacagccgcactcgccaagagcaaaacatccgcttccatttccact
gcgggcagcccggcaacgaaaaaacgcaaggccgaaagcaaagccgtcagtatttcgagt
ctatccgcttggaagcactacgaaaacaacgtaccaacggcggtcctgacgccagacgag
gaagacgattatcacgaccagatgacggcagctactcgaaaggtggagaagtggatggaa
cactaccgactcgctcgagaaagttattggcaaatgcgaaagcagtcgggtatgggtatc
gaaacgtcacagaccaggccgtttggggcaatggatgatgattctgaagcgggagttgat
acgggaggtctcctctgtcgacagtgcttttcgaacgaaccatcttggatgccatctctt
tccggaaagcccaaaattcggcaaatctgtcgtggtgaccaattgatgcgctgtttggaa
tgcacatttgtcgggtgtggaccttcttctaccgcacccagctcagagcagcatattctt
cggcattttttactttcaaatcacaagcttggagtcacgtgtggtcgggaggcccgcgtt
tactgtttgcaatgcggagactttgtataccatgagatttttgaccacgaaagggatcgt
gttgatctggcaacgaaattgccgtggcaagcgtggaagccacatcctgtccagcggtcc
ttcgacgctctccagtttatgcgaatccaggaccagggtattttctggcgaggaatgatt
gccgccttcccacctctggtcccgatcgaacatgttcgtgccgctcaattttgtcgtctt
cggcaagtgttgtttagcggcgaatgggatctgttaccgctgatgacgagtagcacagcg
aagagttttgctcgcgcgcaatgggagaagcctattttccaacgagggcggatactggct
cctgttggtatgtacaaccttggaaacacttgctatcaaagtgctgtgttgcaatgcctc
gtgaattgtgcaccagttcaaaagtatttcctggaacaagtaggccaccatcatagttcg
tgccaaatgtaccggaagacggcaggacgatctatgtcgtcagcttcttcatccaagtcg
aaggcccacagcgtctgtcttgcgtgtgaaattgataaaattttgcttgattacgttggt
agtagtatggggattgatgtacggcaagcattgttagacgtttgcctgccggaacggcga
atctttttgcaagcgtcgacgaagaaagcgagttctactttcaacactcccataaagcaa
ggcgagccactggccccgaccgagatgttggcagcaacttgggtgtgtaaagggatggag
catttggcggggtacgagcaacgtgatgcacatgagtttctacacggctttctcgaagct
ctcggcaagcacacgcaattgtatcgagaaaagatgtacaaaatgatcagcacagttcag
ccgtctaacgccctcatgcctttggaaaatcctattgagcacgactttgtgaagaagacc
tttgaaggcaaacttcggtctgtcctcatatgtcaggaatgtggatcgaagcgtactcag
ctagagtcttttctgagcatttccttgcctctgtcttctgaggttcagagggttactaca
gctttacctggcgattcagacccgtacattgcaaatggtaagctttcggtggagcgttgc
ctacggcatttcactcttccagagttgctatcagctccgattgattgcccatcatgtaaa
aagaaaacccagacgaagaagcagcacgttgtgtcgaagctacccaacgttctctgccta
catttaaagagattcgatgctgcgcaaaataaaaaaattgaagactttgtcgcatttccg
gctcgaaacttgaacatgggtccctatcttccacattggtgcgaggtcaccagtgctccc
gagataggcggcaactctcttcaaagtgcacaggtaatgtacagtcttttcgcaacggtc
aatcatttcgggaatttacaaagcggtcactatgttgctaatgttaaggtcaatgaaaaa
tggtttcattgcaacgatgctcacgtagcacaagctggcatcggaatcggtgagagagaa
gtgcttcaaagcaacgcatatttgctgttctatattcgttcgaaataa

DBGET integrated database retrieval system