KEGG   Phaeodactylum tricornutum: PHATRDRAFT_44806Help
Entry
PHATRDRAFT_44806  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pti  Phaeodactylum tricornutum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pti00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PHATRDRAFT_44806
Enzymes [BR:pti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PHATRDRAFT_44806
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 585 aa AA seqDB search
MPAICCCCDSSAAVAVREDFATRDTSIGNSIIDPSLTRAFMNVPPHFASSSLATADWPTE
AANRLQLRAPSACKVSAEHCVLQYDTTKALLLVVTSTSTDDNRDGEQILDIIDPDDMIGV
KLEIQTTDRFGAARSTSQASAQGEENTFIRATNEPTTDGLADSRGSALLTLFVYPRKDPS
KPSFLNRYGVTTYKPKPDPKYARPTADTLSKLGFRHAHHRTFKLAPTEDLQDCSTVVAAL
RKLCSSQQPSAVSPLRYLIVVNPQSGPKRSGGKLCETQVQPMLEQAGIEVDVCITTHPNH
AQERMAKSSTEEDIAGYDGLVLMGGDGVVHEAYNGLFARADKDELLKKLKIGVIGCGSCN
GFSTSLAHGSHERYGIVAETFLVAKGQSCWHDTSRYQTTTKSYSSFLTFSWAIIADIDIE
SEVLHWLGEPRNDIWAVLRILALRRYQATFSYLPATEATADNTITIPALSDPVPSTWTTV
EDGFYLFWASHVTHAAMHTYHSPNSKFQDGIFEIMIVRGRVSRYRMTRILLALESGNHVG
MPGVEFVQCVAYRLVKETPGSFNDIDGEAVEDGPIQAQVQPHSVQ
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctatctgttgttgctgtgattcgtcggccgctgtagcagtaagagaagacttc
gcaactcgggacaccagcattggcaactccatcattgatcccagcttgacacgcgctttc
atgaatgttcctccacatttcgcatcgtccagcctggcaactgcagactggccgacggaa
gccgcgaaccggctgcagcttcgggcgccttccgcatgtaaagtgtccgccgagcattgt
gtgctacagtacgataccaccaaagcactattgctagtcgtgacgtccacatccacggac
gacaatcgtgacggtgagcaaatactggacatcatcgatccagatgacatgattggggtc
aaactggaaattcaaaccaccgatcgtttcggtgcagctagatcgacttcccaagcgagc
gctcaaggggaagagaacacattcattcgagccaccaacgaacctactactgacggcttg
gctgattctcgaggctccgcgcttttgacgctctttgtctaccctcgtaaggatccctct
aaaccatcattcttgaatcggtacggagttacgacctacaaaccgaaacctgatcccaag
tacgcacgtccgaccgctgacactttatctaaacttggctttcgacatgcgcatcatcgc
acgtttaagttggctcctaccgaagacctacaggactgttcgaccgtggtggctgcccta
cgtaagctatgctcctctcagcaaccgagcgctgtttctcctctgcgttatttgatcgtt
gtcaatccccaatcgggtccgaagcgcagtggaggaaaactatgcgaaacacaggttcag
cccatgctggagcaggctggaattgaagtcgatgtttgcatcacgacgcatccgaatcat
gctcaggaacgcatggcgaagtcgtctacggaagaggatattgctggctacgacggttta
gtgctcatgggcggcgacggtgttgtgcacgaagcatataatgggttgttcgcccgcgct
gataaggacgaactgctaaaaaaacttaagatcggtgtgattggatgtggttcctgtaac
ggcttttcgacgagtttggcccacggtagtcacgaacgttacggaattgtggccgaaacg
ttcttagtggccaagggccagtcctgttggcacgatacgtcgcggtaccaaactacaacc
aaatcctattcttcattcctgaccttttcgtgggcaattattgccgatatcgatatcgaa
tcggaagttttgcactggctgggcgaacctcgcaatgatatttgggccgtcttgcggata
ttggccctgcgccgctaccaagctaccttttcgtatttacccgccacggaggcgaccgcc
gataacaccatcacgataccggccttgtcggatccagtcccctcaacctggactactgtg
gaggatggtttttatctcttttgggcttcccatgtcacccacgccgccatgcacacgtat
cattcgccgaattcaaagtttcaggacggaatctttgaaatcatgattgtacgtggacga
gtttcacgatatcgcatgactcggattctgttggcgctggaatcgggcaatcatgtgggc
atgcccggcgtggagtttgtgcagtgtgtagcctatcgtctagtgaaggaaactccagga
tcgttcaacgatatcgacggagaggccgtggaggacgggccaattcaagcacaagttcaa
ccccactcggttcaa

DBGET integrated database retrieval system