KEGG   Phaeodactylum tricornutum: PHATRDRAFT_45758Help
Entry
PHATRDRAFT_45758  CDS       T01075                                 

Definition
nadph-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PHATRDRAFT_45758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 753 aa AA seqDB search
MILRYSRSVTALSTTFPSVHVLARQRYRAQRLDPSFIGSAGRRGILTRMRSTATVIGHFN
ARRSSFLRPTFAVNEFSPICWYASTTVPLRSLPSIRILFASQGGTAQLFANMLSDALDEK
NVPNVTVQSLADDTPENLVTSSLSSSSDSYYLFLTSTSGVGEPPSNGKVFYDWLMSQSND
SFPTDTNSNNRYYALFGLGNSKAHPSHYNVTSKAMDAKLNELKVMTPLMPLALGDDGDCL
EDDFDQWQEAIVEQIVSRSTLNGESSTLQDDNSATTNTEDAPHAAEAPTPEPTANSDITV
PTESMQCPGAKSGYRRAPIKYPRVLMGPPASSGSNGHAVRRDLLDVAPTFYHERTRAFPV
VHNIALNPVASSNGLRELCVSLPAGDDESVQYQAGDHFTVYPRNKDYLVESYLDFVLDDV
DPHAAILGNVSSTSTNSKPYPHPIDISLYETLSHAVDLNATPSPSFARFLLDGEDGSMDY
KGDIVRHGRTVLDLLLQNSRAGQPKKIALEDLLYQLPPMKARYYSIASSEHTHNRQIYLT
YRPVRYVTSRGALREGVATSYLSGLTTGSTVIAAVHANPSFRLPVDPQVSVCMIAGGCGV
APIRAFLEERIQRAPNSNYGPGWLFLGFRDPNDAVYGDMIATALECGALTHAQVMYNNPL
GGDGTASSLTVDQQEASRGNVSDAVRRNGAAILAHLQNGGYTYLCGGARTFGVAIENEVH
QILQTHGKMSEEEATTYLQRLIHEGRFLEDLSD
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgatacttcgctactctcgttcagtaacagccctgtcgacaacgtttccatcggtccat
gtactcgctaggcagcgttaccgtgcccaacgattggatccttcattcatcggctctgca
ggtcgtcgcggtatcttgacgagaatgcgctcgaccgcgaccgtgatcggccacttcaac
gcaagaagaagcagctttctgcgacctacctttgctgtgaatgagttttctcccatttgt
tggtatgcttcaactactgtaccgctacggtcactaccttcgatccgcatactgttcgcc
tcgcagggggggacggctcagttatttgccaatatgctatcggacgctctcgacgaaaag
aatgtgcccaatgtcaccgttcaatcgcttgcggacgatacgcccgagaacttggttacc
tcctccttgtcatcctcatccgattcgtactatcttttcctgaccagcaccagtggagtc
ggagaaccgccatccaacggcaaagttttctacgactggctcatgtctcagtccaacgat
tcttttcccactgacaccaatagcaataaccgctactacgccttgtttggactggggaat
tccaaagcgcaccccagccactacaatgtgacgagcaaagccatggatgcaaaattgaac
gaactcaaagtcatgacaccgctgatgcctctcgccttgggtgacgacggcgattgtttg
gaagacgattttgatcagtggcaggaagctattgtggagcaaattgtgtcacgcagtaca
ttgaacggggaatcgtccacccttcaagacgacaacagcgccacaacaaataccgaggat
gctccacacgcggccgaagctcccacacctgagccgacggcgaattccgacatcaccgta
ccgacggaatccatgcaatgccctggggcaaaatcgggataccggcgggcgcctatcaaa
tacccacgagttttaatggggccacccgcatcctcgggctccaatggacacgcggtacga
cgcgatctgttagacgtggcacccacgttttaccacgaacggacccgagcctttcctgtg
gtgcacaacatagcgctcaatcccgtggcgtcgtccaatggactccgagaattgtgtgta
tctttgccagcgggcgacgacgaatccgtccaatatcaagccggtgaccactttaccgtc
tatcctcgcaacaaagactatcttgttgagtcctatttggattttgtgttggacgacgtc
gatccgcacgctgccattcttgggaatgtttcctccacctctaccaacagcaagccctat
ccccaccccatcgatatttcactgtacgaaacgctaagtcacgcagtagatttgaacgca
actccttcccccagttttgcacgatttctgctcgacggagaggatggttctatggattat
aagggcgatattgttcgccacggtcggactgttctggatctgctattgcaaaacagtcga
gctggccagccaaagaaaattgctttggaagatctgctgtaccagctaccacccatgaag
gcacgttactactctattgccagctcggaacacacacacaatcgtcaaatttatctcacc
tatcgcccggtccggtacgtcacaagccgtggggcgctgcgggagggagtcgccacttcg
tacttatcgggcttgacaacgggaagtacggtaattgcggccgtccacgccaatccttct
ttccgtctaccggtggacccccaagtatccgtgtgcatgattgctggtggttgcggagta
gcccccattcgcgcgttcttggaagagcgaatccaacgcgcacccaacagcaactacgga
ccgggttggctgtttttgggctttcgtgatcccaacgacgctgtttacggtgacatgata
gctactgctttggaatgtggcgccctcacacacgcccaggtcatgtacaacaatccactg
ggaggcgacggcacggcgtctagtcttacagttgatcagcaggaagcgtcgcgcggcaat
gtttcggacgccgtccgacggaacggcgcagccatactggcacacttgcaaaatggcgga
tacacatacttgtgcggaggagcccgaacctttggagtggcgattgagaatgaagtgcac
cagattttacagacacacggcaagatgagtgaagaggaggccacaacgtacttgcaaagg
cttattcatgaaggacgattcctggaggatctgtccgattga

DBGET integrated database retrieval system