KEGG   Phaeodactylum tricornutum: PHATRDRAFT_45764Help
Entry
PHATRDRAFT_45764  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
pti  Phaeodactylum tricornutum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1603 aa AA seqDB search
MQASQAQLQPQQAPPVAAPLPSAAAQQGSAAAPAVSHYSSQHLSQVPAAQPGLAPQSQGV
VHQQRPVSQGINYTTQTSQSQTPAQQQAPPQQHFPHQGLNGGWQSDKDYQERRKMIAKIV
HLLQQRKPNAPQEWLKKLPQMAKRLEESLYRTATSFEEYNDANTLKHRLQQLAVNIGQKT
KKLQQQQALLAQQRLQQQQQQQQVRQQSDTTQYTPQVPPSTSQQALIQPQTQQGLIPQVK
SAAPPASQVQGQRMVNMSEINPIMGQPTQQQQSAPAPQPPPLQQVQYTQKPPVAPISAPT
PQAPAPAANGPNGQASGRQVSDRQQVLRHQQQRLLLLRHAAKCQHEDGKCPVTPHCAGMK
RLWKHIAECKDQKCLVPHCVSSRYVLSHYHRCKDVRCPVCGPVREAIHRSHEKQKQMQAL
KQRHQQAVQQQGQPQNATSAPAAIGALPVPAPPGHSLEPVTKKQRTAPITALRAPIMPVQ
RLQQPPGTRPAVSHPTTVRPGYTGSQPPITSGPGGPPVAQVPGLAFANGQVVMPKHSGPK
PQEDHTLINCFSVQQIETHISSLSNGLVLPPQKLKTKGLDALKTLQSHQHAWVFNTPVDP
VELGLPDYFEVIKKPMDLGTIRKKLENGVYQRLDDFKEHVLLTFDNAMMYNPEGSVVYNM
ANEMKVKFQSDFVKLMEQLNAEEDVKRKNGEACCLCGCEKLLFEPPVFYCNGINCPSKRI
RRNSYYYIGGNNQYHWCHQCYQELRDNSTIDLGDLSVKKESLVKKKNDEVHEESWVQCDR
CERWVHQICALFNTRQNKDQRSEYACPKCTIDERKAKGELEAKSSTPMAEDLPRTKLSEY
LENHVREKVDEFVEQRSQDMVVAQGCSIEEARSKLKMGGAITIRQVTSMDRRLEVRDRMK
QRYAFKNYPEEFNFRCKCIVVFQNLDGVDVVLFGLYVYEHDEKNPAPNKRAVYVSYLDSV
HYMRPRDMRTFIYHEILISYLDYVRRRGFSTAHIWACPPLRGDDYILYAKPEDQKTPKDD
RLRQWYIDMLIEAQRRGIVGKLTNMYDLYFSNEKNDATVVPYMDGDYFPAEVENIIKDIE
EGKTGKKGSSQGKKKKEKAKQKKKSGRGGTRSTGLDEDALKASGFLPPGTDSKSLEEGAR
DYVMVKLGETIQPMKESFIVAFLGWEGAKEGDMVVPNEIQEHRDLHEITWKLKSSSTKAD
TVETIENESDRQQDAEIKDSRDKKGDSSIKLNGTTSKKPDDTSSSSGNIEDTASTHRAHV
DTPMEGIVKNEFTETNGILQSSPQENKDSESINAPALRVGTEAIDRPDAPQSAITAAPNT
ISIREGKFAAMAARKRDREGEPKEPEEVESTSEKTKEEKLTSITVTDSKGRTVKVLDDDE
EELDCEFLNNRQAFLNLCQGNHYQFDHLRRAKHSSMMVLWHLHNRDAPKFVQQCATCSRE
LLTGYRFNCPTCGDFDQCQDCISNPKVPRHPHQLKPIPVANAQQNELTEAQRKERQRSIQ
LHMTLLLHAATCSSPKCPSANCTKMKGLLKHGAQCQVKATGGCNVCKRIWALLQIHARQC
KAKSCPVPNCMAIRERVRQLKKQQQAMDDRRRQEMNRAYRGKR
NT seq 4812 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctcgcaagcccaactgcagccacaacaggcgccgccggttgccgccccgctt
ccgtcagcggcggcgcaacaaggatcggcggcggcgccggcagtgtcgcactactcatca
cagcacttgtcacaggtgccggctgcgcaacccggtctggcgccgcaatcgcaaggagtt
gttcatcaacagcgcccagtgtcgcaaggtataaactatacgacgcaaacgtcacaatcg
cagacgccggctcagcagcaggctcccccgcaacagcatttccctcaccaaggactcaac
ggcggatggcaaagcgataaggactatcaagagcgccggaaaatgatcgccaagattgtg
catctactgcaacagcgcaagccgaatgctccgcaggaatggttgaagaaacttccgcaa
atggcgaaaagattggaagagtcgctgtatcgcacagcaacgtcctttgaagagtataac
gatgccaacacgttgaagcatcgtttgcagcagttggcggtgaacattggccaaaagacc
aagaagctgcaacaacagcaggcgttgttggctcaacagagactacagcagcagcaacaa
caacaacaggttcggcagcagtctgatacaactcagtacactccccaggtaccgccatct
acttcacagcaagcattaatacagccgcagacgcagcaaggtctaatacctcaagtgaag
agcgccgcgccacctgcgtcacaagtacaaggtcaacggatggtaaacatgtcggaaatc
aacccgataatgggacaaccgacccaacaacagcaaagcgccccagctccacaaccgccg
cctctccagcaagtgcagtacacacaaaagccgcccgtggcccccatttcagcccccact
cctcaggctcccgcaccggccgcaaacggccccaatggccaggcttctggtcgacaagtt
tcggatcgtcaacaggtgttacgccatcaacagcaacggctgctgctactgcgacacgct
gccaaatgtcagcatgaagacggaaaatgcccagtaacgccgcattgcgctgggatgaag
agattgtggaagcatattgccgaatgcaaggatcaaaaatgtcttgtaccgcattgcgtc
agttcccggtacgtgttaagtcattatcaccgatgcaaggacgttcgttgtccagtgtgt
ggcccagtaagggaagccattcatcgaagccacgaaaagcagaaacagatgcaggcccta
aaacagcgacatcagcaggccgtacagcaacagggccaacctcagaatgcgacttcagcg
cccgccgctatcggtgctttgccagtccccgctcctcctggacatagtttggaacctgtt
accaagaaacagcgcaccgcgcccattacagctttgagagctccgatcatgccagttcag
cgacttcagcagccaccaggtactcgtccggccgtttcgcatccaaccacagtaagacct
ggatataccggaagtcaacctcccatcacttctggtcctggtggtccaccggttgcgcaa
gtacctggcctagcgtttgcgaacggacaagtagtaatgccgaaacattcaggaccaaag
ccacaagaagatcacactttgatcaactgcttctctgtccagcaaattgagacgcacata
tcttccttgagcaatgggttggtcctgcctccgcagaaattgaaaacgaaaggattggac
gctcttaaaacgctgcagtcgcaccaacatgcgtgggtattcaacactccagtggatccc
gtggaactcggcttgccggactactttgaggtcatcaaaaaaccaatggatctagggaca
ataaggaagaagctcgaaaatggcgtttatcagaggctggacgacttcaaagagcatgta
ctgcttacatttgataacgccatgatgtacaacccggagggttcggttgtgtataacatg
gctaatgaaatgaaggtaaagtttcagagcgacttcgtaaagctcatggaacaactgaac
gccgaagaagatgtcaagcgaaagaacggggaggcctgttgtttatgcggatgtgaaaag
ctgctatttgagcctcctgtattttattgcaacggaataaattgcccttcgaagcgaatt
cggcgaaacagttattactacattggagggaacaaccaatatcactggtgtcaccagtgc
tatcaagaactccgcgacaattcaaccattgatttaggcgacctttccgttaaaaaagaa
agtctcgtgaagaagaagaatgacgaggtgcacgaagagagctgggtacaatgcgatcgt
tgtgaaagatgggttcatcagatttgtgctttatttaacactcggcaaaataaggatcag
cgatccgaatacgcttgtccgaagtgtacaattgacgaacgaaaggcaaaaggcgagctt
gaggcaaaatcgtcaactccgatggcagaggacctccctcgtaccaagctgtccgagtac
ttggagaatcatgtgcgtgagaaggtcgatgagttcgttgaacagaggtcgcaggatatg
gttgttgctcaaggttgctctattgaagaagccagaagcaaacttaagatgggaggtgca
atcactatccgacaggtaacttccatggacagacgacttgaggtccgagatagaatgaag
caacgctatgcattcaaaaactacccggaagaattcaattttcggtgtaaatgcatcgtt
gtcttccagaatttggacggcgttgatgttgttttgtttggcctttacgtatacgagcat
gatgagaaaaatcctgcccccaacaagcgggccgtctatgtgtcctatctcgatagtgtt
cattacatgagaccacgtgatatgcgtactttcatttaccacgaaattttaatatcttat
cttgattacgtccggaggcgtggattttcgactgctcacatttgggcttgtccgccgctt
cgcggagacgactacatcctttacgcaaaaccagaggaccagaagaccccgaaagacgat
cgattgcgtcagtggtacatagacatgctgattgaggcccaaaggcgagggattgttggg
aaacttaccaacatgtacgacctctatttttccaacgagaaaaacgatgcaacggttgtc
ccctacatggatggtgactactttcctgctgaggttgagaatatcatcaaggatattgag
gaaggcaagacgggaaagaaaggcagttcgcaaggcaaaaagaaaaaagaaaaagccaaa
cagaagaagaagtcaggtcgtggcggaactcggtctacgggattggatgaagacgctctt
aaagcgagcggatttctgccacccggtactgattcaaaaagtctagaagaaggcgctcga
gactacgtcatggtgaaacttggtgagaccatccagcccatgaaggaaagtttcattgtg
gctttcttaggctgggaaggggcgaaagagggagacatggttgttcccaatgagatccaa
gagcaccgtgacctgcatgagatcacttggaaacttaaaagcagtagcaccaaagctgat
acagtggagactatcgagaacgaaagcgataggcaacaggacgccgagatcaaagattct
agggataaaaaaggggacagttcgataaagttaaacggtactacttcaaagaagccggat
gacacgtcctcaagctcaggaaacatcgaagacactgccagcacacatagggctcatgtt
gacacaccgatggaagggattgtaaaaaatgaatttaccgaaaccaatggaattttgcaa
tcctcacctcaagagaataaagactctgaatccatcaacgctcctgcgcttcgtgttgga
actgaggctattgatcgcccggatgctccgcagtccgcgataactgcagcaccaaacact
atttctatccgagagggaaaattcgctgctatggcggcccggaaacgtgatagagaaggg
gagccgaaagagcccgaggaggtggaaagtacaagtgagaagacgaaggaagaaaagctg
acttccataacagtgactgatagcaagggccgtactgtgaaagttttggatgacgacgag
gaggaacttgactgcgagtttctaaacaatcgacaggcgttcttaaatctatgtcaagga
aatcactaccagtttgatcacctgcgccgcgcaaagcactcctccatgatggttttgtgg
caccttcacaacagggatgcaccaaaatttgtgcagcaatgtgcgacttgctccagagaa
cttcttaccggatatcgctttaattgtcctacatgtggggatttcgatcagtgccaagac
tgcatttccaacccgaaggttcctcggcacccgcatcagctcaagcctattccggtggcc
aatgcgcaacaaaacgaattgacggaagcgcaacgcaaggaacgacagcgcagtatccag
cttcatatgactcttttgctgcatgctgctacgtgtagctcgccgaagtgtccgtcagcc
aattgtacaaagatgaagggtcttttaaagcacggcgcgcaatgccaagtgaaggccact
ggcggttgcaacgtatgcaagagaatatgggctttactgcaaattcatgctcgtcagtgc
aaagcgaagtcttgccctgttccgaattgtatggcaatccgtgaaagagttcgccaattg
aaaaagcaacaacaggcgatggatgaccgtcgtcgccaagaaatgaatcgagcttacagg
gggaagcgctaa

DBGET integrated database retrieval system