KEGG   Phaeodactylum tricornutum: PHATRDRAFT_46080Help
Entry
PHATRDRAFT_46080  CDS       T01075                                 

Definition
hypothetical protein
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
pti  Phaeodactylum tricornutum
Brite
Enzymes [BR:pti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PHATRDRAFT_46080
Peptidases [BR:pti01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PHATRDRAFT_46080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 1370 aa AA seqDB search
MNSVLQQLFMMPELRDSMCSAPLPRSLRSSGGSTVLVGNDLVGKKISLQWDTGISYDAFV
EGFNDVTGMHIIRYCPIQIATVGGSTIHQIQPEDIDSLPPVLPEEFILTEGRSGMETGVY
DVVSDVSENLDGNEMSSKAINTIQETEDEKTSRHLLEEFQRTFIHLQEGSKGRCFDPRTL
VEACACLKLEFDVWQQNDASEFATKLLDRLEIALRRWAPEHFRYMDHTFGLKQTKQKICK
QCGMKSNREEKLLNIDCQIRGKSDIHEALAAMTDTELMEGSNKVFCDNCKVNTDTVLRTA
ISTLPNMLILSLKRFDLDYNTFETVKLNSRCAFGQTLNMKPYMLEGLEEAEQGAQGPSPM
ETEDANNSVDVNISPAGKDEDYEYKLAGVLVHAGVAQGGHYYSFIKDRNPGSEEKWYRFD
DEDVTPFDPAAIETECFGGKVKKETKWPNGQLHTIEQEQFANALMLFYEKVKSSDLPPPS
DNPMRQRDINTSVCSTGFDAFEPDVRRANATHRWQSFLFDAEFHAFLKGILGICRIGNPP
GNGGRDDWQKQCVPALLSFVFDVLLYSSDRSALNDWTQMLEEILLSNQEVSKSFVHHLAQ
KCDNVSDNWVRTFLLECPDQSSRQAAVRIFSAAFQSCARLESELKALADWTAAWKQQMEQ
LSVQQREANRLVALPCVLEREWKGFEDTNKLDGSASSMGKIISFLNVLLEALPRSFRFNA
EVFTFVRNLATMLLEGDENPFTLALIEALIPARLVTLAVRDRVASPLCLAFPGLSVPVEV
ARSQLRAESNASSHMMSMNTNHSLNGPDMNSIRGPTHSDLMALFEALVCILGLPGAVHVP
IVRDLEDLGRGRHKFALNETTVKALTAVFQECCSPGAPGMGQREIEIYLSRCDVDAANVS
KQKINDIMSKYPIAKCDHDLPGSNFLSLEGFLAYYEDTVQTNDVRVRADLHTFGFRPDLT
RRSRLSRLVPVRNQEKDRKPPESVAIDVAETFRDGFADLGRYGNLGLSSSPALFVLADSV
SEALSQYLIAAATYRRDTNSLTLATLQEIHRTPNDWNGSESIGASLNILMVIAATPDDDQ
DERISRIMSSQGKAARNVEYGAGILQVLRAFFRTRQAQQFSNEMRWGYERYVGLLKELRR
VYPVFVWMNNHRDQWSFVEREVLDSASRLQGKFRTEYVHRVPDHAIQSDHNSHADSDMAN
INDSDDDSQLSPADHYNGREISIPNSEANDGPYQIVVEGAGNSSVNGVYHQCGYFEGGCR
YAMSGNWRNERYRFFIFQCNVSNNTKHWYISIVPYDSQPGTSADIDFYTAPATSDFLRVP
PHTGWVKSQEGTDPLPRLTYKRLSSEGGTPERVLNGSVLEESDKSDSPYI
NT seq 4113 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgtacttcagcagttatttatgatgccagagctacgggattcaatgtgttca
gcccctttaccgaggtctctccgctcttcagggggctctacggttttagtcggaaatgac
cttgtcgggaaaaagatttcgctgcaatgggacacaggtatttcatacgatgcttttgtt
gaaggctttaatgacgtcactggtatgcacattatccgatattgcccgatacagattgcc
acggttggtggttccacaatacatcagattcaaccggaggacattgacagcctgcctcca
gtcctaccggaagagttcattcttaccgaaggacgctccggtatggaaaccggcgtctat
gacgttgtatcagatgtatctgaaaatttagacggcaatgaaatgtcctcgaaagcaatc
aacacgatccaagaaacggaggacgagaagacatcacgacacctgttggaagagttccaa
cgaacattcattcacttacaagagggatcgaaaggtcgctgtttcgatccacgcactctc
gtggaggcttgcgcctgtctaaagctggagttcgacgtttggcagcagaatgacgcttct
gaatttgccactaagcttcttgacagattggagatcgcattgagacgttgggcccctgag
cactttagatatatggatcatacctttggtttgaagcaaacgaagcaaaagatatgcaag
cagtgcggtatgaaatcgaatcgtgaagagaaactactaaatattgattgccaaattcga
gggaaatctgacattcacgaagcgttggctgcgatgaccgatacggagctaatggaaggg
agtaacaaagttttttgcgacaactgcaaagtaaacaccgatactgttttaaggacagcg
atctcaacgcttcccaatatgcttattttatcactgaagcggttcgatctggactacaac
actttcgagactgtgaaactaaacagtcgatgcgcctttggacaaactcttaatatgaaa
ccgtacatgttggaaggactagaggaagccgagcaaggcgcacagggaccttcacccatg
gaaacggaagacgccaataattcagttgacgtcaacatttcccccgctggcaaagatgag
gactacgagtataaactcgctggagtacttgtgcacgccggagttgctcaaggtggtcac
tactacagctttatcaaggaccgcaaccctggctccgaagaaaagtggtatcgctttgat
gacgaagatgtaactcctttcgatccagcagctattgagacggaatgcttcgggggcaaa
gtaaagaaagagacgaagtggccgaatgggcaactgcatactattgaacaagagcagttc
gcgaacgctctcatgcttttttacgagaaagtgaaatcttcagacttgcccccaccatct
gataacccgatgcgacagcgggacatcaatacttcagtttgctccactggcttcgatgcg
ttcgagcccgatgttcgtagagccaatgcaactcatcgatggcaatcttttctttttgac
gccgaatttcatgcctttttaaagggaattttgggaatttgccgaattggcaatcctcca
ggcaatggcgggagggatgattggcaaaaacaatgcgtgcctgcgttactttcttttgtg
tttgacgttcttctctattcgtccgaccggagtgcgctgaacgattggactcaaatgctg
gaagagatacttttgagcaaccaagaagtctccaagtcctttgttcatcatctcgctcaa
aaatgtgacaatgttagcgacaattgggttcgaacgtttctgcttgagtgccccgaccag
agctcacgccaggctgcagtgcgaatctttagcgctgcttttcaatcatgtgcacgactt
gaatctgagcttaaagcgctggcagattggaccgctgcttggaaacaacaaatggaacaa
ctatcggtgcagcaacgagaggctaatcggcttgtggctcttccctgtgtactagagaga
gagtggaaaggctttgaggatacaaacaaattggatggctccgcttcaagcatggggaaa
ataatatcttttctgaatgttttgttggaggctttgccgaggagctttcgtttcaatgca
gaggtctttacgtttgtgcgcaacttggctacaatgcttttggaaggtgatgagaatccg
tttactctcgctttgatcgaagcgttgattcctgcgagactcgtcactctagccgtgcgg
gatcgggtagcaagtccactctgcctggcttttccaggtctttcggtaccagtggaagtt
gcccgcagccagcttcgggcggagtcgaacgcgtcctcgcacatgatgtcgatgaatacc
aatcattctttgaacgggccagacatgaacagtattagaggcccgacgcattcggatttg
atggcactttttgaagcactagtgtgcattttgggtttaccaggggcagttcacgttcca
attgtgcgtgatttggaagatttaggaagaggcagacacaaatttgcactcaatgagacc
accgtgaaagcgctcaccgcagtctttcaggaatgttgttcaccgggcgctccaggcatg
ggccagcgtgaaatcgaaatctatctaagcagatgcgatgtcgacgcggcaaacgtgtca
aaacaaaagataaacgatatcatgtccaagtaccccattgctaaatgcgaccacgatctt
cctggcagcaattttttaagcctcgaaggtttccttgcttattacgaggacactgttcaa
acgaatgacgtacgcgttcgggccgacttgcacacatttggatttcggcctgatcttacg
agacgatcgaggctttcccggcttgtccctgtacggaatcaagagaaggatagaaaaccg
ccagagagtgttgcgattgatgtagcagagacgttcagagatggatttgctgatctaggc
cgctacggaaacctgggtttgagtagtagtccagctctatttgtgctcgccgacagtgtt
agcgaagcactttcccagtacctcatcgctgcagctacttaccgtcgcgacaccaatagc
ctcacgctggcgacgcttcaggaaatccatagaacgccaaatgattggaacggatcggaa
tccatcggcgcttcgctgaatattttgatggttattgcagctacaccggatgatgatcaa
gatgagagaatatccagaatcatgtccagccaaggtaaagctgcccgcaacgtagaatat
ggagcgggtattttgcaggttcttcgagctttctttcgtacacgtcaagcgcagcagttc
agcaacgaaatgcgatggggctatgagcggtacgtcggtttattgaaggaactccgtcgt
gtttatcccgtctttgtttggatgaacaaccatcgagaccagtggagttttgtagaacgt
gaagtgttggattcagcttctcgactccaaggaaaatttcgaaccgagtacgtccaccgt
gtacccgaccacgcaattcaatctgatcacaattcacacgctgattccgatatggcaaac
ataaacgattcggacgatgactctcagctttcgccggccgatcattacaacgggcgcgaa
attagcatccccaattccgaagccaacgatggtccatatcagattgtcgtggaaggcgca
ggaaattcttccgtaaatggtgtgtaccaccagtgcggctatttcgaaggtgggtgccgc
tacgccatgtcgggaaattggcgcaacgaacggtatcgcttcttcatctttcagtgcaac
gttagcaataataccaagcattggtacatctccatagttccctacgacagccagcccggt
acatcagcagacattgacttttacactgccccggcgacatctgatttcttgcgcgtgccg
ccccacactggttgggtcaagtcacaagaaggcaccgacccattaccacgcttgacttac
aaacggttatcttctgaaggcggtacgcctgagcgtgtgttgaatggatctgttttggaa
gagagcgacaaaagtgattctccgtacatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system